Ruangan Relaksasi dan Perawatan di dalam Pesawat


 

EFRA UMARA 224111089

NOVRI HANGORO 224111090

PUTRA ADIPRATAMA 224111268

BAB 1
Pendahuluan

Didalamduniapenerbangansangatlahdituntutakankeselamatandanjugakenyamananbagiparapelangganmaskapaipenerbangan, baiksaat pre­­-Flight maupun post flight. Bagiparapenumpang yang menggunakanjasapenerbanganbiasanyamembutuhkanwaktu yang cukup lama.

Untukmembuatpenumpangsemakinnyamandidalampesawat, banyakpenumpang yang membutuhkanrelaksasi, agar perjalanantidakmelelahkandanmenjenuhkan, dikarenakanjugamayoritaspenumpangjasaangkutanudaraadalahseorangpebisnis yang membutuhkankenyamanandanrelaksasi.

Khususnyauntukpenerbanganjarakjauhsepertipenerbanganinternasionaldanbagiparawanita yang tidaksempatdenganwaktuuntukpergiketempatperawatandanrelaksasi, makapihakair line menyediakanruangrelaksasidengan yang ahlidalamrelaksasidanperawatan.

Makadenganinikelompok kami mengangkagtjudultentang “RuanganRelaksasidanPerawatandidalamPesawat.

Bab II

LandasanTeori

 

Pembahasanpadababinitujuannyalebihkepadapenyajianfasilitasdan service lebihuntukparapenumpangpesawat yang inginmerelaksasikantubuhpadasaatperjalananmenujutempattujuankhususnyaparapenumpangdengantempuhjarakjauh. Disini kami menyajikanfasilitasberupareleksasidanperawatanuntukkenyamananlebihbagiparapenumpangpesawat.

Untukrelaksasinya kami menyediakan service berupa :

–          Pijat

–          Aroma terapi

–          Totok aura danlainnya

 

Untukperawatannya kami menyediakanberupa :

–          Spa

–          Pedicure danmedicure

–          Earcandle

–          Creambathdanlainnya

Demikianpelayanan yang kami sediakandari “refleksidanperawatan” di dalampesawat

Bab III

MetodologiPenelitian

            DalamMetodologiPenelitiansangatlahpentinguntukmelengkapiinformasidan data-data yang akurat, untukmemecahkanmasalahdaripembahasankaryailmiahini, darijudul “RuanganRelaksasidanPerawatandidalamPesawat”.

MetodologiPenelitian yang kami gunakandalamtulisaniniadalahmetodeobservasiyaitumelaluipengamatanlangsungdankuisionerkepadapelanggan-pelanggandanpemilik salon.Denganmelekukanpenelitianini kami mendapatkaninformasidangambaran yang harusdilakukandalammembuat “RuanganRelaksasidanPerawatandidalamPesawat”.

Target responden kami adalahpelanggan-pelanggandanpemilik salon khususnyawanita, kuisioner yang kami buatberisipertanyaan-pertanyaan yang menyangkutrelaksasidanperawatan, sehinggarespondenmengertidanmudahmengisikuisioner yang dibuat.

Penambahan Fasilitas Spa dan Sauna Didalam Pesawat Udara


 

Nama Anggota            :           

Irfan Handi Prabowo              ( 2241.10.041 

David Prihanto                        ( 2241.10.090 )

Mhamdhani                             ( 2241.10.043 )

 BAB I

1.1 Latar belakang masalah

 

Penambahan Fasilitas Spa dan Sauna Didalam Pesawat Udara

 

Saat ini transportasi merupakan salah satu aspek ekonomi yang sangat dinamis. Dalam perkembangannya ekonomi membutuhkan jasa transportasi yang cukup memadai terutama transportasi udara yang dikarenakan seiring pesatnya pembangunan dan pekembangan ekonomi yang di capai bangsa bangsa di dunia, peran transportasi udara semakin di butuhkan, karena beberapa keunggulan yang dimiliki, diantaranya kecepatan, kemampuannya untuk mencapai lokasi yang memiliki jangkauan strategis dan bernilai ekonomi tinggi dalam waktu yang relative singkat.

Dalam kasus ini  membahas tentang Penambahan fasilitas  In-Flight service. In-Flight Service merupakan kegiatan penting dalam kegiatan penerbangan. Kegiatan pelayanan In-Flight merupakan unit pelayanan yang langsung berhubungan dengan penumpang. Adapun peranan dari In-Flight itu sendiri adalah memberikan kenyamanan dan pengalaman penumpang selama berada didalam pesawat udara.

Berdasarkan uraian tersebut maka penulis tertarik untuk membahas masalah penambahan Fasilitas Spa dan Sauna didalam pesawat udara.

 

1.2  Identifikasi masalah

 

Berdasarkan latar belakang di atas, maka identifikasi  permasalahannya dapat dirumuskan sebagai berikut :

                                                                                                                              

  • Kapasitas pengguna fasilitas spa dan sauna di dalam pesawat
  • Siapa saja yang berhak menggunakan fasilitas spa dan sauna didalam pesawat

 

1.3 Rumusan masalah

Berdasarkan latar belakang masalah tersebut yang menjadi perumusan masalah yang akan di teliti adalah penambahan fasilitas spa dan sauna di dalam pesawat udara.

 

1.4 Tujuan penelitian

Tujuan diadakan penelitian ini adalah:

  • Untuk mengetahui jumlah Kapasitas pengguna fasilitas spa dan sauna di dalam pesawat
  • Untuk mengetahui Siapa saja yang berhak menggunakan fasilitas spa dan sauna didalam pesawat

 

1.5 Manfaat penelitian

  1. a.       Bagi Penulis

Bermanfaat untuk menambah wawasan pengetahuan tentang fasilitas spa dan sauna didalam pesawat

 

  1. b.      Bagi Lembaga STMT TRISAKTI

Bermanfaat sebagai bahan penambah referensi untuk dosen dan mahasiswa STMT TRISAKTI jurusan Manajemen Transportasi Udara.

 

 

 

 

 

 

BAB II

2.1 Landasan teori

2.2 Spa dan Sauna

            SPA adalah bahasa modern dari pijat. SPA pada dasarnya pijat dengan siat su ala jepang atau pijat tradisional yang dilakukan para terapis sangat profesional sehingga para pengunjung merasa dimanjakan dan juga dikerjakan sesuai dengan permintaan pengunjung.

http://cewe-spa.blogspot.com/2007/09/definisi-spa.html

 

Ritual spa seperti yang kita kenal sekarang sudah dikenal bangsa Romawi lebih dari 2000 tahun yang lalu. Tahun 25 SM, Raja Agrippa membangun Roman Thermae pertama yang merupakan sebuah spa skala besar pertama yang dikenal peradaban manusia. Thermae dilengkapi dengan pusat hiburan seperti pusat olahraga, restaurant dan berbagai

macam bentuk perawatan tubuh. Pengunjung thermae menjalani rutinitas seperti apa yang kita lakukan saat ini di spa-spa modern, berolahraga, sauna, berendam, pijat dengan minyak rempah, scrubing kemudian diakhiri dengan relaksasi di perpustakaan atau ruang duduk.

 

Sejarah dan Perkembangan Spa, spa adalah perawatan tradisional yang menggunakan air sebagai medianya. Spa berasal Bahasa Latin ‘salus per aquam’ yang artinya sehat melalui air. Ada juga yang menyebutkan bahwa Spa merupakan nama sebuah kota di Belgia yang memiliki pemandian air panas, tempat ini kerap digunakan bangsawan Romawi ketika ingin terapi relaksasi menggunakan air, biasanya dilakukan untuk memanjakan diri setelah perjalanan jauh. Nama spa kemudian berkembang ke seluruh Eropa, dan kini dipakai di seluruh dunia untuk tempat terapi air.

Gaya hidup orang yang tinggal di kota besar biasanya dipadati dengan aktivitas sehingga lebih rentan stres. Stress menjadi persoalan kesehatan yang sering menyerang masyarakat perkotaan. Untuk menghilangkannya dapat dilakukan dengan cara relaksasi. Disinilah spa menjadi salah satu alternatif untuk rileksasi agar pikiran kembali segar. Selain itu, spa juga bermaanfaat untuk mengencangkan, menghaluskan dan memberi nutrisi pada kulit serta melancarkan peredaran darah. Berbagai manfaat yang sesuai dengan gaya hidup metropolitan itu menyebabkan spa semakin tumbuh dan berkembang di kota-kota besar.

Spa seringkali dianggap sebagai tempat perawatan tubuh berupa pijat atau massage. Padahal pengertian spa sebenarnya adalah tempat dimana orang dapat memperoleh perawatan badan, dari ujung rambut sampai ujung kaki sekaligus mengembalikan kesegaran tubuh setelah berada di posisi yang menegangkan. Perawatan spa terdiri dari creambath, facial, manicure-pedicure, lulur, scrub, foot spa, dan body treatment.

Aromatherapy massage merupakan elemen penting dalam memberikan relaksasi. Dengan menggunakan campuran minyak khusus yang juga bermanfaat untuk refreshing, penghangatan, melegakan pernafasan dan penenangan diri. Kini spa merupakan paket lengkap dari aroma dan suasana yang menenangkan, pelayanan ramah serta pemandangan yang menyejukan jiwa.

Tawarkan Konsep Spa Sesungguhnya, Konsep spa telah berkembang menjadi tempat pelayanan perawatan seluruh tubuh yang menawarkan berbagai macam program antara lain perawatan sehabis melahirkan, penurunan berat badan, perawatan pra nikah dan lainnya.

Saunas telah ada selama ribuan tahun dan kini sedang menemukan kembali di seluruh dunia untuk kesehatan dan manfaat sosial. Sauna menggila telah dikalahkan Utara dan Amerika Selatan, Eropa, Asia, dan Afrika. Sauna, mandi uap, dan Turki mandi kadang-kadang digunakan secara bergantian untuk menggambarkan santai dan menguntungkan ini bentuk mandi. Apakah ada perbedaan? Artikel ini akan mendefinisikan dan menggambarkan masing-masing disebutkan di atas bak mandi dan panas.

Sauna adalahbagian integral dari budaya Finlandia dan Swedia. Mereka menghasilkan panas kering antara 70 dan 100 derajat Celcius. Dari waktu ke waktu air dipanaskan dilemparkan pada batu, menghasilkan uap awan tebal dan membuat ruangan terasa panas. Setelah di sauna antara sepuluh dan tiga puluh menit, sebagian besar orang berenang atau mandi air dingin. Pada musim dingin bulan, beberapa orang bahkan berguling di salju.

Kebanyakan rumah di Finlandia dan Swedia memiliki ruang sauna. Di negara-negara itu adalah peristiwa sosial dan dapat mencakupanggota keluarga, teman atau rekan bisnis. Mereka selalu diambil dalam telanjang. Apakah laki-laki dan perempuan mengambil satu bersama-sama tergantung pada usia dan hubungan mereka. Sauna publik biasanya satu-seks.

Swedia sauna telah menjadi populer di Amerika Utara dan sering merupakan bagian dari fasilitas kolam umum. Setiap renang kebijakan menetapkan sendiri pada ketelanjangan. Beberapa renang memiliki periode tertentu untuk single-seks digunakan saat berenang dan telanjang nude sauna diperbolehkan. Di lain waktu mungkin pakaian renangdiperlukan.

Mandi uap

Mandi uap memiliki tingkat kelembaban yang konstan sekitar 100%. Mereka ditahan di sekitar 40 derajat Celsius, suhu yang jauh lebih rendah daripada tradisi Swedia, dan banyak orang lebih suka mandi uap. Kelembaban yang tinggi membuat bernapas lebih mudah dan memiliki efek menguntungkan pada sistem pernapasan.

Turkish Bath

Turki mandi ini juga dikenal sebagai hamam. Hal ini sangat mirip dengan mandi uap. Turki tradisional mandi adalah bangunan besar dan berfungsi sebagai sosialtempat pertemuan serta tempat-tempat untuk mendapatkan bersih. Ada kamar terpisah untuk pria dan wanita, dan bangunan mandi dibagi menjadi panas, hangat, dan sejuk daerah.

Hot Tub

Panas bak merujuk pada bak besar air panas di mana orang mandi terendam. Hot tubs tidak seperti sauna, uap-dan Turki mandi, yang hanya uap. Ketiga jenis wadah yang digunakan untuk bak mandi panas adalah tong kayu, fiberglass pusaran air, atau bak mandi besar.

Tipe pertama dibuat daribilah kayu dan memiliki pompa air dan sistem penyaringan untuk mengedarkan dan air bersih. Biasanya dipasang di luar ruangan dengan bangku-bangku di sekitarnya sehingga orang dapat nyaman dengan hanya rendam kepala mereka di atas permukaan air.

Fiberglass pusaran tekanan tinggi ‘jet’ yang membuat efek pusaran air. Jet air berguna untuk pijat atau hidroterapi. Kolam renang umum atau klub kesehatan sering memiliki pusaran air fiberglass. Ini juga dikenal sebagai ‘Jacuzzi’ setelah perusahaan yangmempopulerkan mereka.

Jenis bak mandi air panas kadang-kadang disebut jacuzzi tub. Mereka sering dipasang di rumah-rumah sebagai pengganti bak mandi biasa. Mereka sedikit lebih besar daripada bak mandi tradisional dan memiliki fitur mirip dengan fiberglass pusaran air.

Saunas, uap-dan Turki mandi, dan bak air panas semua kadang-kadang disebut sebagai spa atau perawatan spa. Sebuah spa juga bisa menjadi resor yang menawarkan perawatan tubuh seperti pijat dan hidroterapi. Banyak yang mempunyai fasilitas spa dengan mandi uap dan panas bak mandi.

 

BAB III

3.1 Metodologi Penelitian

Jenis penelitian

            Penelitian yang digunakan dalam penyusunan skripsi ini adalah menggunakan metode penelitian deskriptif kualitatif yaitu menurut Krisyatono (2006:69) penelitian yang berusaha menggambarkan atau melukiskan objek yang di teliti berdasarkan fakta yang ada dilapangan sedangkan data kualitatif adalah data yang berbentuk kata, kalimat, skema dan gambar.

Hasil Penelitian dan Pembahasan

            Seperti yang dijelaskan sebelummnya, pengambilan data dalam penelitian ini di peroleh dengan cara melakukan pengumpulan secara tertulis yang di tuangkan dalm pertanyaan yang di tunjukan kepada responden yang dijadikan sampel dan( informan biasa) konsumen yang berjumlah 10 orang. Dalam menentukan informan dalam penelitian ini menggunakan teknik purposive sampling.

Berdasarkan penelitian yang telah dilakukan terhadap 10 responden

NO Nama Responden Setuju / Tidak setuju Alasan Responden
1 Taufan Setuju Menikmati fasilitas di dalam pesawat
2 Prama Setuju Memiliki kesan yang berbeda
3 Hakiki Setuju Memanfaatkan waktu  untuk kesehatan di dalam pesawat
4 Bimantara Tidak Setuju Sangat aneh menurut saya keberadaan spa dan sauna di dalam pesawat
5 Bony Setuju Memberikan pengalaman yang berbeda
6 Agung Setuju Meningkatkan kualitas transportasi udara
7 Ichsan Setuju Pelayanan nomer satu yang diberikan
8 Ajis Setuju Baik untuk kesehatan di perjalanan
9 Fajar Setuju Kenyamanan berlebih selama di perjalanan
10 Risky Setuju Meningkatkan kenyamanan penumpang

Sumber : Hasil Penelitian

Membina Hubungan Yang Harmonis Dengan  Konsumen    

Dalam penelitian ini, penulis akan menjelaskan indikator strategi penerapan spa dan sauna didalam pesawat udara.

Berdasarkan tabel diatas, suatu kegiatan penerapan spa dan sauna yang diadakan didalam pesawat berguna untuk mencapai pemasaran yang menghasilkan kepuasan dan keharmonisan dalam peningkatan kualitas transportasi udara.

FAKTOR-FAKTOR PENYEBAB RENDAHNYA TINGKAT PENGAWASAN PETUGAS PADA PT. ANGKASA PURA I DI BANDARA KUALA NAMU


Nama :

Irfan Handi Prabowo           224110041

M. Hamdhani M.S                 224110043

Miranti Pratiwi Lantah         224110056

David Prihanto                       224110090

Kelompok :    6

S1 MTU D (11)

Baca lebih lanjut

Tiket Pesawat Murah Citilink yang Menjebak Konsumen


Tiket Pesawat Murah Citilink yang Menjebak Konsumen

Kelompok:

1. Naufal Ali Hamdi  224111254

2. Efra Umara  224111089

3. Novri Hanggoro  224111090

4. Aditya Wisnu W  224112047

GH Kelas D

BAB I PENDAHULUAN

Jumlah penumpang transportasi udara di Indonesia semakin meningkat dari tahun ke tahun. Pada tahun 2012 jumlah penumpang domestik mencapai 60 juta penumpang meningkat 20% dari tahun sebelumnya. Indonesia adalah negara kepulauan yang sangat luas, membentang dari Sabang sampai Merauke. Hal ini membuat kebutuhan akan transportasi yang cepat dan murah sangat tinggi seiring dengan tingkat pendapatan masyarakat yang meningkat.

Tidak seperti beberapa dekade yang lalu, sekarang ini jasa transportasi udara sudah bisa dinikmati oleh masyarakat tingkat menengah maupun rendah. Seiring dengan masuknya konsep bisnis LCC di Indonesia, membuat maskapai yang berbasis LCC bersaing menjual harga tiket serendah-rendahnya untuk mendapatkan hati di masyarakat. Tidak sedikit juga maskapai yang sudah menutup usahanya dikarenakan tidak mampu lagi bersaing harga.

Meskipun begitu, banyak masyarakat yang merasa ditipu atau dirugikan karena telah membeli tiket murah, namun pihak maskapai boleh seenak-enaknya mengganti jadwal penerbangan yang sangat merugikan calon penumpang. Bahkan ada calon penumpang yang tidak diberitahu akan penggantian jadwal tersebut. Calon penumpang tidak diberitahu bahwa untuk menikmati fasilitas maskapai lainnya harus membayar lagi dan lain sebagainya. Salah satu dari sekian banyak maskapai yang menjual tiket murah adalah Citilink.

Banyak calon penumpang yang merasa dirugikan karena telah merasa tertipu oleh maskapai Citilink yang menjual tiket murah. Berapa banyak calon penumpang yang pernah mengalami hal serupa? Apakah dilain waktu mereka akan menggunakan jasa maskapai yang telah menipunya lagi? Atau mereka justru pindah ke maskapai lain dengan pelayanan lebih baik? Jadi seberapa efektifkah penerapan penjualan harga tiket murah Citilink dalam menarik hati para konsumen?

Dengan tujuan menjawab pertanyaan-pertanyaan di atas dan mencarikan solusi terbaik untuk calon penumpang maupun pihak Citilink agar tetap mendapatkan kesetiaan para konsumennya, kami memilih judul Tiket Pesawat Murah Citilink yang Menjebak Konsumen.

SOCIAL MEDIA AS AN AIRLINE’S TOOL FOR INTERACTION (ENGLISH VERSION)


Kelompok      : 10

Ketua             : Rahmadya Karisma Haris (224110327)

Anggota        :

Veronica (224110019)

Meyta Rezky S. (224110101)

Sherly Septirani (224110224)

Kelas              : S1-ZU-10

INTRODUCTION

Information Technology is growing rapidly and has become a part of daily life. Almost all informations can be easily accessed by public. Not only the public but the company also has used information technology to make approach with its customers, because there is no doubt that information technology creates new spaces that allow users to expand the network and operations can help companies in achieving wider market share .

The role of technology is much needed in every field of transport, such as transport by land, sea and air. Social media is also being the attention of the airline because they found it easier to get closer to customer by providing an easy access to all the information. For example, Indonesia Air Asia using the other social media beside their own website, such as facebook and twitter.

Is using the social media can really create loyalty from customers to the airlines? Then do they feel helped by the presence of companies who use social media such as a forum to get the information they want quickly and easily?

In essence, people would prefer something that allows him to perform daily activities and easily accessible than a complicated thing. This tendency will form a habit of costumers that in their  daily life was already struggling with a lot of social media. Then the airline’s presence in social media is increasingly making customer feel easier and more comfortable when they want to access schedules, routes, promotions, and other things around on the airline through social media. Moreover, customer more freely express their comments and suggestions to the airline. The objective is obvious, that the airline wants a two-way communication and good interaction between them and their costumers. Refers to the phenomenon, we do the research that is intended to determine how much influence of SCRM implementation to the consumer loyalty level.

 

THE THEORETICAL BASIS

The company surely wants their costumers have a high level of loyalty to the company, it can be represented by repeat purchases undertaken by the customer to the company’s products, for which CRM is required. According to Storbacka and Lehtinen (2001:3) CRM is to build relationship strategies that refine relationship and thus increase their value. Companies in developing customer-oriented business culture-centric intended to win the hearts of consumers. Implementation of CRM also includes the company’s operational activities such as marketing, sales, and services, as well as for analysis of the exploitation of customer data to improve the performance of the company such as customer financial data, marketing data, and other data services.

Three phases of CRM by Kalakota and Robinson (2004:121) to be performed by the company are as follows:

1)    Acquire: acquire new customers by providing easy access to information, new innovations and exciting services.

2)    Enhance: Improve relationships with existing customers by providing good services to the customers (Customer Service). Application of cross selling or up selling the second phase could increase the company’s revenue and reduce the cost to acquire customers (Reduce Cost).

3)    Retain: retaining customers is the company’s efforts to gain customer loyalty by listening to our customers and strive to meet customer needs.

As the development of technology grows and so does the ability of communities to interact on social media, the traditional CRM had evolved into SCRM (Social Costumer Relationship Management). Social CRM is the approach taken by the company and supported by technology to help companies solve business problems in dealing and interacting with customers. Social CRM can be regarded as a major change in business approach to solving customer problems involving social media such as: twitter, facebook, or other social platform.

Social CRM is a philosophy and a business strategy, supported by a technology platform, business rules, workflow, processes and social characteristics, designed to engage the customer in a collaborative conversation in order to provide mutually beneficial value in a trusted and transparent business environment. It’s the company’s response to the customer’s ownership of the conversation.-Greenberg (2010:34 ),

Hence, by using the concept of Social CRM, there is a correlation between people (the public), process (how automation and CRM application), and technology (software and social media) that can affect customer loyalty.

 

RESEARCH METHOD

We use research methods: spreading questionnaires and doing interviews. Questionnaires and structured interviews conducted in this study created and developed based on variables that have been defined as people, process and technology. This research questionnaire contains many questions that will also identify the significance of these variables on the dependent variable we are customer loyalty characterized by repeat purchases.

Our target/respondents are all the internet users and the people who are not Internet users but use the other people to use the Internet for their interests. This online questionnaire then spreaded through twitter and facebook to respondents and structured interviews will be conducted with experts.

Our research type is descriptive research. Descriptive research is a type of researh that is undertaken in order to describe the characteristics of the variables of interest in a situation (Sekaran, 2006:158). The variables people are the man behind the account or social media page which is representative of the airlines the airlines or we can say administrator. Variable process is a form of interaction in the form of discussion and provision of information between the administrator and users. Variable technology is a media technology that bridges the interaction, in this case: social media Social-CRM activities undertaken by the airlines. Meanwhile, the dependent variable is customer loyalty, the indicators are repeat searches for information until repeat purchases ​​by costumer.

 

ANALYSIS

Respondent Characteristics by Sex

Based on the results of the questionnaire, the data obtained characteristics of respondents by sex. As many as 38% of respondents are men, while 62% are women. Although  most of our respondents are women, but the percentage gap is not too far.

jenis kelamin
Characteristics of Respondents by Age

Based on the results of the questionnaire, the data obtained characteristics of respondents by age. As many as 80% of respondents aged between 18-25 years. This means, most respondents considered a young age. As many as 13% of respondents aged 26-35. A total of 4% of respondents are under age 18. 3% of respondents are aged over 35 years.

usia

Characteristics of Respondents by Jobs

Based on the results of the questionnaire, respondents characteristic data obtained by the job. Most of the respondents are students with percentage 71%. It means that the population we research are users who accessed the internet and social media are mostly the students. 25% of respondents have jobs as private sector employees. Respondents who have a job as a civil servant at 3% and the remaining 1% have other jobs.

pekerjaan

From the data we got that the intensity of Internet usage by 55% of our respondents stated they use it very often, followed by 35% of respondents stated frequently use the internet. Respondents who rarely use the internet are only 9%, and no respondents who have never used the internet. Other data we got from the questionnaire that we shared declared activities to access and find information about the airlines over the internet shows a relatively big difference that 88% of respondents claimed that they have accessed or found information about the airlines, while 12% have never accessed or searched for information about the airline. The data is consistent with our study that the use of the internet to search for information about the airlines are very often.

Analyzing variable ‘technology’ for the question items 1, 2 and 3, we obtained data that respondents frequently access the Internet and they ever used the internet to search for information about airlines, and social media accounts used by respondents to access information about the airlines: The airline website is the most selected media and used by respondents with a percentage of 80%. Twitter is used as a social media where respondents are using this to access information about the airlines showed as a percentage of 17%, whereas facebook is used by 3% of respondents.

media yang digunakan

Searching information through social media is easy to do, this is because social media has become part of people’s lifestyles, especially among the young who can easily access through the gadgets they own.

Analyzing variable ‘people’ for question number 4 about the latest information by admin of airline’s social media, question number 5 about admin responses, and question 8 about  admin’s language and words that are used in responsing to the customers, we found that respondents agree social media admins always provide the latest information and able to respond to costumer’s problems, suggestions, and complaints and also use polite language with each percentage exceeds 50%. This number of percentage is good. But from the question number 6 and 7 about variable people found that 58% of respondents said that the admin does not always respond and reply to questions from the customer, also by 68% of respondents stated that the admin is not quick in replying to a question from the customer. This means that the admin responds the customer although not all suggestions, questions, or complaints responded quickly.

Analyzing variable ‘process’ for the questions number 9, 10, and 11 are about the assessment of social media usage, the information that is searched about the airlines, and costumer’s opinions about information that is provided. Respondents showed that social media is an effective media for airlines to provide information. The information that is searched by respondents are : promo for 51%, followed by information about the flight fare with a percentage of 35%, schedules and routes by 14%. Respondents considered that the information provided through social media is helpful, it is indicated by the percentage of 90%.

informasi yang dicari

 

Correlation between the variables people, process and technology

From the results we have collected, it appears that there is a relationship between people, process and technology. It was seen from the good response from the admin via social media can influence customers to make a purchase decision and make airlines as a customer preferences. Usage of technology; internet and social media are easily accessible from their gadget makes it easier to customer to search information about the airlines. Although the data by 59% of respondents do not conduct periodic information retrieval, but by 61% of respondents make a purchase and 67% of respondents make it as a preference to make airlines.

The decision to purchase

keputusan pembelian

Decision making airline as a preference

menjadikan preferensi
So it can be seen that the three variables are related one another and give effects to consumers in making purchasing decisions that also affect customer loyalty.

 

CONCLUSION

From the survey results we got, we  conclude that people make it as a preference. It is because the routine provision of information through social media that make most of the customers who can easily access social media feel that the provision of this information is very helpful to them in knowing the latest information about the promo or flight schedules. Even though people do not always seek information regularly but the general public still make the purchase.

Although admin’s responds are not quick in responsing to their problems and do not always replying the input provided by the customer, the information from airlines through social media will influence customer decisions in making a purchase then make them buy the airline’s products, either normal flight fare or promotion of ticket. By making that airlines to be such a maket preference, indicating that the formation of customer loyalty.

 

ADVICE
Airlines: recommended for aviation enterprise to have an employee to serve as the permanent administrator in managing and responsible to social media that is owned by the airlines. The goal is if the customers need information about the airlines, admin can reply and respond quickly so that the customers can quickly get the informations that they need.

Society: recommended for the public who use air transport as a derived demand for the needs, using social media is helpful to obtain information about promotion or other informations from the airlines, because nowadays the airlines have been using social media to be able to close the gap and to approach the community and expect two-way conversation that can enhance CRM’s airlines. Moreover, this is done so that the public not being close-minded from the development of information technology to access all the information needed.

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 5)


Kelompok      : 10

Ketua             : Rahmadya Karisma Haris (224110327)

Anggota        :

Veronica (224110019)

Meyta Rezky S. (224110101)

Sherly Septirani (224110224)

Kelas              : S1-ZU-10

KESIMPULAN

Dari hasil survey yang kami dapatkan, kami menarik kesimpulan bahwa masyarakat menjadikan airlines yang menggunakan media sosial sebagai preferensinya. Hal ini dikarenakan adanya pemberian informasi yang rutin melalui media sosial yang membuat mayoritas costumer dapat mengakses media sosial dengan mudah, merasa bahwa pemberian informasi ini sangat membantu mereka dalam mengetahui informasi terbaru, baik itu mengenai promo ataupun jadwal penerbangan meskipun masyarakat tidak selalu mencari informasi secara berkala namun masyarakat secara umum tetap melakukan pembelian.

Selain itu, walaupun respon admin tidak cepat dalam menganggapi permasalahan dan tidak selalu membalas input yang disampaikan oleh customer, pemberian informasi dari airlines melalui media sosial mempengaruhi keputusan customer dalam melakukan pembelian terhadap produk yang dijual oleh airlines, baik penerbangan dengan harga promo maupun penerbangan dengan normal fare. Sehingga dengan dijadikannya airlines tersebut sebagai preferensi, menunjukkan terbentuknya loyalitas dari konsumen.

SARAN

Airlines :  disarankan untuk perusaahaan penerbangan agar memiliki karyawan untuk bertugas sebagai admin tetap dalam mengelola media sosial yang dimiliki oleh airlines tersebut. Tujuannya adalah jika customer membutuhkan informasi tentang airlines,maka admin tersebut dapat membalas dan merespon dengan cepat sehingga customer dapat dengan cepat mendapatkan informasi yang dibutuhkan.

Masyarakat : disarankan untuk masyarakat secara umum yang menggunakan transportasi udara sebagai derived demand bagi keperluannya, penggunaan dari media sosial cukup membantu dari memperoleh informasi baik suatu promo atau informasi lainnya dari airlines, karena saat ini airlines telah menggunakan media social untuk dapat mendekatkan jarak dengan masyarakat dan diharapkan terjadi percakapan dua arah yang dapat memberikan input bagi airlines sehingga dapat meningkatkan CSR airlines itu. Selain itu, hal ini dilakukan agar masyarakat juga tidak tertutup dari kemajuan dan perkembangan teknologi informasi untuk mengakses segala informasi yang dibutuhkan.

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 4)


Kelompok      : 10

Ketua             : Rahmadya Karisma Haris (224110327)

Anggota        :

Veronica (224110019)

Meyta Rezky S. (224110101)

Sherly Septirani (224110224)

Kelas              : S1-ZU-10

ANALISIS

Karakteristik Responden Berdasarkan Jenis Kelamin

Berdasarkan hasil kuesioner, didapat data karakteristik responden berdasarkan jenis kelamin. Sebanyak 38% responden adalah pria, sementara 62% adalah wanita. Meskipun wanita lebih banyak, tapi gap persentase bisa dibilang tidak terlalu jauh.

Karakteristik Responden Berdasarkan Usia

Berdasarkan hasil kuesioner, didapat data karakteristik responden berdasarkan usia. Sebanyak 80% responden berusia antara 18-25 tahun. Ini berarti, kebanyakan responden tergolong usia muda. Sebanyak 13% responden berumur 26-35 tahun. Sebanyak 4% adalah responden dengan usia dibawah 18 tahun. Sebesar 3% adalah responden berumur diatas 35 tahun.

Karakteristik Responden Berdasarkan Pekerjaan

Berdasarkan hasil kuesioner, didapat data karakteristik responden berdasarkan pekerjaan. Kebanyakan responden adalah mahasiswa dan atau pelajar dengan persentase 71%. Ini berarti dari populasi yang kami teliti sebagian besar pengguna internet dan pengakses media sosial adalah mahasiswa dan atau pelajar. Sebesar 25% responden memiliki pekerjaan sebagai karyawan swasta.  Responden yang memiliki pekerjaan sebagai pegawai negeri sebesar 3% dan sisanya sebesar 1% memiliki pekerjaan lainnya.

Dari data yang kami dapatkan bahwa intensitas penggunaan internet oleh responden kami sebesar 55% menyatakan sangat sering menggunakan internet, dilanjutkan dengan responden sebesar 35% menyatakan sering menggunakan internet. Responden yang jarang menggunakan internet hanya sebesar 9%, dan tidak ada responden yang tidak pernah menggunakan internet. Data lainnya yang kami dapatkan dari hasil kuesioner yang kami sebarkan menyatakan kegiatan mengakses dan mencari informasi tentang airlines melalui internet menunjukan perbedaan yang relatif besar yaitu 88%  responden menyatakan pernah mengakses atau mencari informasi tentang airlines sedangkan 12% menyatakan tidak pernah mengakses atau mencari informasi. Data ini sesuai dengan penelitian kami bahwa penggunaan internet untuk pencarian informasi tentang airlines sangat sering dilakukan.

Menganalisis variable technology dari hasil pengolahan data untuk item pertanyaan ke-1, 2 dan 3 didapatkan data bahwa para responden sering mengakses internet dan pernah mencari informasi tentang airlnes menggunakan internet, serta akun sosial media yang digunakan oleh responden untuk mengakses informasi tentang airlines: Website airline adalah media terbanyak yang dipilih dan digunakan responden dengan persentase sebesar 80%. Twitter digunakan sebagai media sosial dimana responden menggunakan media ini untuk mengakses informasi tentang airlines dinyatakan dalam persentase 17%, sedangkan facebook digunakan oleh 3% responden.

Pencarian informasi melalui media sosial dinilai mudah dilakukan, hal ini dikarenakan media sosial sudah menjadi bagian dari gaya hidup masyarakat, terutama kalangan usia muda yang dengan mudah dapat mengakses melalui gadget yang dimiliki.

Menganalisis variabel people dari hasil pengolahan data untuk item pertanyaan ke-4 tentang pemberian informasi terkini oleh admin media sosial, pertanyaan 5 tentang respon admin, dan pertanyaan 8 tentang bahasa yang digunakan admin dalam menanggapi costumer didapatkan bahwa responden setuju admin social media selalu memberikan informasi terkini dan mampu menanggapi permasalahan, saran, dan keluhan costumer dan juga menggunakan bahasa yang sopan dengan masing-masing persentase melebihi 50%. Angka ini masuk dalam kategori baik.  Tetapi dari pertanyaan ke-6 dan 7 variabel people didapatkan bahwa sebesar 58% responden menyatakan admin tidak selalu merespon dan membalas pertanyaan dari costumer, juga sebesar 68% responden menyatakan bahwa admin lambat dalam membalas pertanyaan dari costumer. Hal ini berarti bahwa admin merespon dan menanggapi costumer walaupun tidak semua saran, pertanyaan, ataupun keluhan ditanggapi dengan cepat.

Menganalisis variabel process dari hasil pengolahan data untuk item pertanyaan ke-9, 10, dan 11 tentang penilaian penggunanaan media sosial, informasi yang dicari tentang airlines dan opini customertentang informasi yang berikan. Didapatkan hasil bahwa responden menilai media sosial merupakan media yang cukup efektif bagi airlines untuk memberikan informasi. Informasi yang paling banyak dicari oleh responden adalah : promo sebesar 51%, dilanjutkan dengan informasi tentang harga tiket dengan presentase 35%, jadwal dan rute sebesar 14%.  Responden menilai bahwa informasi yang diberikan melalui media sosial sangat membantu, hal ini ditunjukkan dengan adanya prosentase sebesar 90%.

Kolerasi antara variabel people, process dan technology

Dari hasil yang kami kumpulkan, terlihat bahwa terdapat hubungan antara people, process dan technology. Hal itu terlihat dari respon yang baik dari admin melalui media sosial dapat mempengaruhi keputusan customer untuk melakukan pembelian dan menjadikan airlines tersebut sebagai preferensi customer. Penggunaan technology; internet dan media sosial yang mudah diakses melalui gadget membuat customer lebih mudah dalam melakukan pencarian informasi tentang airlines. Walaupun dengan data sebesar 59% responden tidak melakukan pencarian informasi secara berkala, namun sebesar 61% responden melakukan pembelian dan 67% menjadikan airlines tersebut sebagai preferensi.

Keputusan melakukan pembelian

Keputusan menjadikan airline sebagai preferensi

Sehingga dapat dilihat bahwa ketiga variable tersebut saling berhubungan antara satu dan lainnya dan memberikan pengaruh kepada keputusan konsumen dalam melakukan pembelian yang berdampak dengan timbulnya loyalitas pelanggan.

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 3)


Kelompok      : 10

Ketua             : Rahmadya Karisma Haris (224110327)

Anggota        :

Veronica (224110019)

Meyta Rezky S. (224110101)

Sherly Septirani (224110224)

Kelas              : S1-ZU-10

Metodologi Penelitian

Kami menggunakan metode penelitian dengan menyebar kuesioner dan wawancara langsung. Kuesioner dan wawancara langsung terstruktur yang dilakukan dalam penelitian ini dibuat dan dikembangkan berdasarkan variabel-variabel yang telah ditentukan seperti people, process dan technology. Kuesioner penelitian ini berisi tentang pertanyaan-pertanyaan yang juga akan mengidentifikasi seberapa signifikan variabel-variabel tersebut terhadap variabel dependen kami yaitu loyalitas pelanggan yang ditandai dengan pembelian berulang.

Target responden kami adalah seluruh pengguna internet maupun masyarakat umum yang bukan pengguna internet tetapi memanfaatkan orang lain dalam penggunaan internet untuk kepentingannya. Kuesioner online kemudian disebarkan lewat twitter dan facebook kepada responden dan wawancara langsung terstruktur akan dilakukan dengan dosen ahli.

Jenis penelitian kami adalah penelitian deskriptif. Penelitian deskriptif adalah penelitian yang dilakukan untuk mengetahui dan menjadi mampu untuk menjelaskan karakteristik variabel yang diteliti dalam suatu situasi (Sekaran, 2006:158). Variabel people merupakan orang dibalik suatu akun atau page  media sosial dari airlines yang merupakan representasi dari pihak airlines. Variabel process merupakan bentuk interaksi dalam bentuk perbincangan maupun pemberian informasi antara admin dan pengguna internet. Variable technology merupakan media yang menjembatani interaksi tersebut, dalam hal ini adalah media sosial dalam kegiatan Social-CRM yang dilakukan oleh airlines. Sementara itu pada variabel dependen yaitu loyalitas pelanggan, indikatornya adalah kontinuitas pencarian informasi sampai pembelian berulang yang dilakukan oleh costumer.

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 2)


Kelompok      : 10

Ketua             : Rahmadya Karisma Haris (224110327)

Anggota        :

Veronica (224110019)

Meyta Rezky S. (224110101)

Sherly Septirani (224110224)

Kelas              : S1-ZU-10

Landasan Teori

Perusahaan pastinya menginginkan jika para pelangannya memiliki tingkat loyalitas yang tinggi terhadap perusahaan, hal tersebut dapat tercermin dengan cara pembelian berulang yang dilakukan para pelangan terhadap produk yang dihasilkan perusahaan, untuk itulah CRM diperlukan. Menurut Storbacka dan Lehtinen (2001:3) CRM merupakan hubungan yang kooperatif antara provider dengan pelanggan sehingga kedua pihak sama-sama untung melalui pembentukan hubungan yang dapat meningkatkan nilai mereka.

Perusahaan dalam mengembangkan kultur usahanya berorientasi costumer-centric yang ditujukan untuk merebut hati konsumen. Penerapan CRM pun mencakup kegiatan operasional perusahaan seperti pemasaran, penjualan, dan pelayanan, juga untuk analisis eksploitasi data konsumen demi meningkatkan kinerja perusahaan seperti data finansial pelanggan, data pemasaran, dan data layanan lainnya.

Tiga tahapan CRM menurut Kalakota dan Robinson (2004:121) yang dapat  dilakukan oleh perusahaan adalah sebagai berikut:

1)  Acquire: mendapatkan pelanggan baru dengan memberikan kemudahan pengaksesan informasi, inovasi baru, dan pelayanan yang menarik.

2)  Enhance: Meningkatkan hubungan dengan pelanggan yang telah ada melalui pemberian pelayanan yang baik terhadap pelanggannya (Customer Service). Penerapan cross selling atau up selling pada tahap kedua dapat meningkatkan pendapatan perusahaan dan mengurangi biaya untuk memperoleh pelanggan (Reduce Cost).

3)  Retain: mempertahankan pelanggan merupakan usaha perusahaan untuk mendapatkan loyalitas pelanggan dengan mendengarkan pelanggan dan berusaha memenuhi keinginan pelanggan.

Seiring berkembangnya teknologi dan kemampuan masyarakat dalam berinteraksi di social media maka CRM tradisional pun berevolusi menjadi SCRM (Social Costumer Relationship Management). Social CRM merupakan pendekatan yang dilakukan oleh perusahaan dan didukung oleh teknologi untuk membantu perusahaan memecahkan masalah bisnisnya dalam menghadapi dan berinteraksi dengan pelanggan. Social CRM dapat dikatakan sebagai perubahan besar dalam pendekaran bisnis untuk memecahkan masalah pelanggan dengan melibatkan twitter, facebook, atau dengan platform social lainnya.

Social CRM adalah sebuah filosofi dan strategi bisnis yang didukung oleh platform teknologi, aturan bisnis, proses, dan karakteristik sosial, dirancang untuk melibatkan pelanggan dalam percakapan kolaboratif dalam rangka memberikan nilai yang saling menguntungkan dalam lingkungan bisnis yang terpercaya dan transparan -Greenberg (2010:34),

Maka dengan menggunakan konsep Social CRM, terdapat korelasi antara people (masyarakat umum), process (otomatisasi cara dan penerapan CRM), dan technology (perangkat lunak dan social media) yang dapat mempengaruhi loyalitas pelanggan.

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 1)


Kelompok      : 10

Ketua             : Rahmadya Karisma Haris (224110327)

Anggota        :

Veronica (224110019)

Meyta Rezky S. (224110101)

Sherly Septirani (224110224)

Kelas              : S1-ZU-10

Pendahuluan

Teknologi informasi berkembang dengan sangat cepat dan telah menjadi bagian dalam kehidupan sehari-hari. Hampir seluruh informasi dengan mudahnya dapat diakses oleh masyarakat pada umumnya. Bukan hanya dari kalangan masyarakat umum tetapi perusahaan pun telah menggunakan teknologi informasi untuk melakukan pedekatan dengan para customer, karena tidak dapat dipungkiri bahwa teknologi informasi menciptakan ruang baru yang memberikan kesempatan bagi penggunanya untuk memperluas jaringan dan dapat membantu kegiatan operasional perusahaan dalam meraih pangsa pasar yang lebih luas.

Peran teknologi juga sangat diperlukan dalam setiap bidang transportasi, seperti transportasi darat, laut dan udara. Media social pun tidak luput dari perhatian perusahaan penerbangan karena mereka berpendapat bahwa akan lebih mudah untuk mendekatakan diri kepada pelanggan dengan memberikan kemudahan dalam mengakses segala informasi. Salah satu contohnya adalah Air Asia Indonesia yang menggunakan media lain selain website perusahaan penerbangan itu sendiri, Air Asia Indonesia menggunakan media social  seperti facebook dan twitter.

Apakah dengan menggunakan media social tersebut benar-benar dapat menciptakan loyalitas dari pelanggan terhadap airlines? Lalu apakah masyarakat terbantu dengan hadirnya perusahan yang menggunakan media social tersebut sebagai wadah untuk mendapatkan informasi yang mereka inginkan secara cepat dan mudah?

Pada hakekatnya, manusia akan lebih memilih sesuatu yang memudahkan dirinya dalam melakukan kegiatan sehari-hari dan mudah dijangkau daripada hal yang mempersulitnya. Kecenderungan ini akan membentuk suatu kebiasaan dari costumer yang dalam kehidupan sehari-harinya pun sudah berkutat dengan banyak social media. Lalu kehadiran airline dalam social media semakin membuat costumer merasa mudah dan nyaman ketika ingin mengakses jadwal, rute, promosi, dan hal lainnya seputar airline melalui social media. Terlebih lagi, costumer lebih leluasa mengutarakan saran dan komentar mereka kepada airline tersebut. Tujuannya jelas bahwa perusahaan penerbangan ingin adanya hubungan timbal balik yang baik dan terjaganya interaksi dengan costumers.

 

The Cause of delay in The Flight



(224110051) Yusnita Desmawari Putri
(224110212) Natasya Octora
Grade: S1 MTU A– 2010

Analysis
In our fourth article, we will explain about our analysis of the cause of the delay of a flight consisting of several factors.
We analyze our research method based on an online survey that we did that the cause of flight delays come from internal factors, namely technical constraints, constraints oprasional and time slot. Also external factors weather.
Most of our respondents chose that which causes flight delays are caused by external factors (weather) and some of them chose to internal factors as the reason.
For more details,please open the following link: http://www.surveyonics.com/surveyflow/keterlambatan-pesawat/10969

The Cause of Delay In The Flight


 

(224110051) Yusnita Desmawari Putri
(224110212) Natasya Octora
Grade: S1 MTU A– 2010

Research Methods”
In our third article, we will conductre search method based on the title of our paper is “TheCause of Delay In The Flight“. To obtain data about the title, we use the descriptive research method.
In collecting the data, we use the internet is to do an online survey and literature review. Here’s the link we use to conduct online surveys and magazines

http://www.surveyonics.com/surveyflow/keterlambatan-pesawat/10969 and “TRANSPORT Magazine” as our literature in collecting data.
The survey we are doing by asking questions about the factors in a delay of the flight.
Target respondents of the online survey is approximately 35 people who we think enough for us to analyze our writing.
Similarly,the research method we can write.

The cause of delay in the Air


(224110051)Yusnita Desmawari Putri
(224110212)Natasya Octora
Grade: S1MTUA– 2010

BasisTheory
In our second article, we take the theoretical basis of the title of our paper is “The cause of the delay in the Airfrom several sources that weget from magazines and Law.
Here is the cause of the delayof a flight that weget from magazinesTRANSPORT Vol. No.28. 1,June 2010are:
1.Ramp Handling
That delayin performing load cargo and postal packaging, hygiene in accuracies aircraft handling time, charging or disposal offuel is enough to occupy a lot of time, and delays in handling catering for passengers.
2.Terminal Handling
That delay in check-in process, handling the grouping passengers, and baggage handling.
3.Operational Handling
That is the problem with the flight documents.
4.Technical Problem
That is the damage to the aircraft or replacement of aircraft for some technical reasons.
5.External
That weather issues or problems with the immigration and customs.

Next,here are the others ources we have obtained from the Law  Decree No. 1 of 2009 Chapter 1 Article1 of the Flight Delay. Containing “Delay in Flight is the time difference between the time of departure or arrival time of departure or arrival realization.

The Cause of Delay In The Flight


(224110051)YusnitaDesmawariPutri
(224110212)NatasyaOctora
Grade: S1MTUA– 2010

Preliminary
The main products of the company or the airlines is to provide passenger and goods transportation services are fast, secure, and comfortable. The performance of the airlines can be seen from the three main aspects of safety and security, timeliness, and service.Of these three aspects, in general airlines in Indonesia has not shown his best quality, most still in the unfavorable category. The low quality of aviation safety and security in Indonesia,marked by a high number of accidents.
So also with the things that should go togetherie flight punctuality and service level stobeless attention. Specifically flight punctuality problems. The purposeof this research is tofind out what are the factors that cause delays flights in Indonesia and the reasons for flight delays.
Flight punctuality is one of the main products of the airlines can be a benchmark of professionalism of the airlines, its users, the government and its rivals. Airlines is a business that is very sensitive to the image, when the airlines are experiencing delays departure, the negative image will be attached to the minds of its service users.
For example, the reason why many users choose the services of domestic flight services? because passengers usually only see in terms of affordable ticket prices, flight schedules that fit, and comfortin flight.Even in terms of timeliness was not amajor reason. Therefore, the performance of the airline in terms of  domestic flights punctuality still does not meet consumer expectations.

The Cause Of Delay In the Flight


(224110051) Yusnita Desmawari Putri
(224110212) Natasya Octora
Grade: S1 MTU A – 2010

Preliminary
The main products of the company or the airlines is to provide passenger and goods transportation services are fast, secure, and comfortable. The performance of  the airlines can be seen from the three main aspects of safety and security, timeliness, and service. Of these three aspects, in general airlines in Indonesia has not shown his best quality, most still in the unfavorable category. The low quality of aviation safety and security in Indonesia, marked by a high number of accidents.
So also with the things that should go together ie flight punctuality and service levels to be less attention. Specifically flight punctuality problems. The purpose of this research is to find out what are the factors that cause delays flights in Indonesia and the reasons for flight delays.
Flight punctuality is one of the main products of the airlines can be a benchmark of professionalism of the airlines, its users, the government and its rivals. Airlines is a business that is very sensitive to the image, when the airlines are experiencing delays departure, the negative image will be attached to the minds of its service users.
For example, the reason why many users choose the services of domestic flight services? because passengers usually only see in terms of affordable ticket prices, flight schedules that fit, and comfort in flight. Even in terms of timeliness was not a major reason. Therefore, the performance of the airline in terms of domestic flights punctuality still does not meet consumer expectations.

SOCIAL MEDIA AS AN AIRLINE’S TOOL FOR INTERACTION (ENGLISH VERSION)


SOCIAL MEDIA AS AN AIRLINE’S TOOL FOR INTERACTION

15 Desember 2012

Kelompok      : 10

Ketua             : Rahmadya Karisma Haris (224110327)

Anggota         :

Veronica (224110019)

Meyta Rezky Setiorini (224110101)

Sherly Septirani (224110224)

Kelas              : S1-ZU-10

INTRODUCTION

Information Technology is growing rapidly and has become a part of daily life. Almost all informations can be easily accessed by public. Not only the public but the company also has used information technology to make approach with its customers, because there is no doubt that information technology creates new spaces that allow users to expand the network and operations can help companies in achieving wider market share .

The role of technology is much needed in every field of transport, such as transport by land, sea and air. Social media is also being the attention of the airline because they found it easier to get closer to customer by providing an easy access to all the information. For example, Indonesia Air Asia using the other social media beside their own website, such as facebook and twitter.

Is using the social media can really create loyalty from customers to the airlines? Then do they feel helped by the presence of companies who use social media such as a forum to get the information they want quickly and easily?

In essence, people would prefer something that allows him to perform daily activities and easily accessible than a complicated thing. This tendency will form a habit of costumers that in their  daily life was already struggling with a lot of social media. Then the airline’s presence in social media is increasingly making customer feel easier and more comfortable when they want to access schedules, routes, promotions, and other things around on the airline through social media. Moreover, customer more freely express their comments and suggestions to the airline. The objective is obvious, that the airline wants a two-way communication and good interaction between them and their costumers. Refers to the phenomenon, we do the research that is intended to determine how much influence of SCRM implementation to the consumer loyalty level.

 

THE THEORETICAL BASIS

The company surely wants their costumers have a high level of loyalty to the company, it can be represented by repeat purchases undertaken by the customer to the company’s products, for which CRM is required. According to Storbacka and Lehtinen (2001:3) CRM is to build relationship strategies that refine relationship and thus increase their value. Companies in developing customer-oriented business culture-centric intended to win the hearts of consumers. Implementation of CRM also includes the company’s operational activities such as marketing, sales, and services, as well as for analysis of the exploitation of customer data to improve the performance of the company such as customer financial data, marketing data, and other data services.

Three phases of CRM by Kalakota and Robinson (2004:121) to be performed by the company are as follows:

1)    Acquire: acquire new customers by providing easy access to information, new innovations and exciting services.

2)    Enhance: Improve relationships with existing customers by providing good services to the customers (Customer Service). Application of cross selling or up selling the second phase could increase the company’s revenue and reduce the cost to acquire customers (Reduce Cost).

3)    Retain: retaining customers is the company’s efforts to gain customer loyalty by listening to our customers and strive to meet customer needs.

As the development of technology grows and so does the ability of communities to interact on social media, the traditional CRM had evolved into SCRM (Social Costumer Relationship Management). Social CRM is the approach taken by the company and supported by technology to help companies solve business problems in dealing and interacting with customers. Social CRM can be regarded as a major change in business approach to solving customer problems involving social media such as: twitter, facebook, or other social platform.

Social CRM is a philosophy and a business strategy, supported by a technology platform, business rules, workflow, processes and social characteristics, designed to engage the customer in a collaborative conversation in order to provide mutually beneficial value in a trusted and transparent business environment. It’s the company’s response to the customer’s ownership of the conversation.-Greenberg (2010:34 ),

Hence, by using the concept of Social CRM, there is a correlation between people (the public), process (how automation and CRM application), and technology (software and social media) that can affect customer loyalty.

 

RESEARCH METHOD

We use research methods: spreading questionnaires and doing interviews. Questionnaires and structured interviews conducted in this study created and developed based on variables that have been defined as people, process and technology. This research questionnaire contains many questions that will also identify the significance of these variables on the dependent variable we are customer loyalty characterized by repeat purchases.

Our target/respondents are all the internet users and the people who are not Internet users but use the other people to use the Internet for their interests. This online questionnaire then spreaded through twitter and facebook to respondents and structured interviews will be conducted with experts.

Our research type is descriptive research. Descriptive research is a type of researh that is undertaken in order to describe the characteristics of the variables of interest in a situation (Sekaran, 2006:158). The variables people are the man behind the account or social media page which is representative of the airlines the airlines or we can say administrator. Variable process is a form of interaction in the form of discussion and provision of information between the administrator and users. Variable technology is a media technology that bridges the interaction, in this case: social media Social-CRM activities undertaken by the airlines. Meanwhile, the dependent variable is customer loyalty, the indicators are repeat searches for information until repeat purchases ​​by costumer.

 

ANALYSIS

Respondent Characteristics by Sex

Based on the results of the questionnaire, the data obtained characteristics of respondents by sex. As many as 38% of respondents are men, while 62% are women. Although  most of our respondents are women, but the percentage gap is not too far.

jenis kelamin
Characteristics of Respondents by Age

Based on the results of the questionnaire, the data obtained characteristics of respondents by age. As many as 80% of respondents aged between 18-25 years. This means, most respondents considered a young age. As many as 13% of respondents aged 26-35. A total of 4% of respondents are under age 18. 3% of respondents are aged over 35 years.

usia

Characteristics of Respondents by Jobs

Based on the results of the questionnaire, respondents characteristic data obtained by the job. Most of the respondents are students with percentage 71%. It means that the population we research are users who accessed the internet and social media are mostly the students. 25% of respondents have jobs as private sector employees. Respondents who have a job as a civil servant at 3% and the remaining 1% have other jobs.

pekerjaan

From the data we got that the intensity of Internet usage by 55% of our respondents stated they use it very often, followed by 35% of respondents stated frequently use the internet. Respondents who rarely use the internet are only 9%, and no respondents who have never used the internet. Other data we got from the questionnaire that we shared declared activities to access and find information about the airlines over the internet shows a relatively big difference that 88% of respondents claimed that they have accessed or found information about the airlines, while 12% have never accessed or searched for information about the airline. The data is consistent with our study that the use of the internet to search for information about the airlines are very often.

Analyzing variable ‘technology’ for the question items 1, 2 and 3, we obtained data that respondents frequently access the Internet and they ever used the internet to search for information about airlines, and social media accounts used by respondents to access information about the airlines: The airline website is the most selected media and used by respondents with a percentage of 80%. Twitter is used as a social media where respondents are using this to access information about the airlines showed as a percentage of 17%, whereas facebook is used by 3% of respondents.

media yang digunakan

Searching information through social media is easy to do, this is because social media has become part of people’s lifestyles, especially among the young who can easily access through the gadgets they own.

Analyzing variable ‘people’ for question number 4 about the latest information by admin of airline’s social media, question number 5 about admin responses, and question 8 about  admin’s language and words that are used in responsing to the customers, we found that respondents agree social media admins always provide the latest information and able to respond to costumer’s problems, suggestions, and complaints and also use polite language with each percentage exceeds 50%. This number of percentage is good. But from the question number 6 and 7 about variable people found that 58% of respondents said that the admin does not always respond and reply to questions from the customer, also by 68% of respondents stated that the admin is not quick in replying to a question from the customer. This means that the admin responds the customer although not all suggestions, questions, or complaints responded quickly.

Analyzing variable ‘process’ for the questions number 9, 10, and 11 are about the assessment of social media usage, the information that is searched about the airlines, and costumer’s opinions about information that is provided. Respondents showed that social media is an effective media for airlines to provide information. The information that is searched by respondents are : promo for 51%, followed by information about the flight fare with a percentage of 35%, schedules and routes by 14%. Respondents considered that the information provided through social media is helpful, it is indicated by the percentage of 90%.

informasi yang dicari

 

Correlation between the variables people, process and technology

From the results we have collected, it appears that there is a relationship between people, process and technology. It was seen from the good response from the admin via social media can influence customers to make a purchase decision and make airlines as a customer preferences. Usage of technology; internet and social media are easily accessible from their gadget makes it easier to customer to search information about the airlines. Although the data by 59% of respondents do not conduct periodic information retrieval, but by 61% of respondents make a purchase and 67% of respondents make it as a preference to make airlines.

The decision to purchase

keputusan pembelian

Decision making airline as a preference

menjadikan preferensi
So it can be seen that the three variables are related one another and give effects to consumers in making purchasing decisions that also affect customer loyalty.

 

CONCLUSION

From the survey results we got, we  conclude that people make it as a preference. It is because the routine provision of information through social media that make most of the customers who can easily access social media feel that the provision of this information is very helpful to them in knowing the latest information about the promo or flight schedules. Even though people do not always seek information regularly but the general public still make the purchase.

Although admin’s responds are not quick in responsing to their problems and do not always replying the input provided by the customer, the information from airlines through social media will influence customer decisions in making a purchase then make them buy the airline’s products, either normal flight fare or promotion of ticket. By making that airlines to be such a maket preference, indicating that the formation of customer loyalty.

 

ADVICE
Airlines: recommended for aviation enterprise to have an employee to serve as the permanent administrator in managing and responsible to social media that is owned by the airlines. The goal is if the customers need information about the airlines, admin can reply and respond quickly so that the customers can quickly get the informations that they need.

Society: recommended for the public who use air transport as a derived demand for the needs, using social media is helpful to obtain information about promotion or other informations from the airlines, because nowadays the airlines have been using social media to be able to close the gap and to approach the community and expect two-way conversation that can enhance CRM’s airlines. Moreover, this is done so that the public not being close-minded from the development of information technology to access all the information needed.

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 5)


Kelompok      : 10

Ketua                :  Rahmadya Karisma Haris (224110327)

–          Veronica (224110019)

–          Meyta Rezky Setiorini (224110101)

–          Sherly Septirani (224110224)

Kelas              :  ZU10

KESIMPULAN

Dari hasil survey yang kami dapatkan, kami menarik kesimpulan bahwa masyarakat menjadikan airlines yang menggunakan media sosial sebagai preferensinya. Hal ini dikarenakan adanya pemberian informasi yang rutin melalui media sosial yang membuat mayoritas costumer dapat mengakses media sosial dengan mudah, merasa bahwa pemberian informasi ini sangat membantu mereka dalam mengetahui informasi terbaru, baik itu mengenai promo ataupun jadwal penerbangan meskipun masyarakat tidak selalu mencari informasi secara berkala namun masyarakat secara umum tetap melakukan pembelian.

Selain itu, walaupun respon admin tidak cepat dalam menganggapi permasalahan dan tidak selalu membalas input yang disampaikan oleh customer, pemberian informasi dari airlines melalui media sosial mempengaruhi keputusan customer dalam melakukan pembelian terhadap produk yang dijual oleh airlines, baik penerbangan dengan harga promo maupun penerbangan dengan normal fare. Sehingga dengan dijadikannya airlines tersebut sebagai preferensi, menunjukkan terbentuknya loyalitas dari konsumen.

SARAN

Airlines :  disarankan untuk perusaahaan penerbangan agar memiliki karyawan untuk bertugas sebagai admin tetap dalam mengelola media sosial yang dimiliki oleh airlines tersebut. Tujuannya adalah jika customer membutuhkan informasi tentang airlines,maka admin tersebut dapat membalas dan merespon dengan cepat sehingga customer dapat dengan cepat mendapatkan informasi yang dibutuhkan.

Masyarakat : disarankan untuk masyarakat secara umum yang menggunakan transportasi udara sebagai derived demand bagi keperluannya, penggunaan dari media sosial cukup membantu dari memperoleh informasi baik suatu promo atau informasi lainnya dari airlines, karena saat ini airlines telah menggunakan media social untuk dapat mendekatkan jarak dengan masyarakat dan diharapkan terjadi percakapan dua arah yang dapat memberikan input bagi airlines sehingga dapat meningkatkan CSR airlines itu. Selain itu, hal ini dilakukan agar masyarakat juga tidak tertutup dari kemajuan dan perkembangan teknologi informasi untuk mengakses segala informasi yang dibutuhkan.

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 4)


Kelompok 10

Ketua            :  Rahmadya Karisma Haris (224110327)

–          Veronica (224110019)

–          Meyta Rezky Setiorini (224110101)

–          Sherly Septirani (224110224)

Kelas            :  ZU10

ANALISIS

Karakteristik Responden Berdasarkan Jenis Kelamin

Berdasarkan hasil kuesioner, didapat data karakteristik responden berdasarkan jenis kelamin. Sebanyak 38% responden adalah pria, sementara 62% adalah wanita. Meskipun wanita lebih banyak, tapi gap persentase bisa dibilang tidak terlalu jauh.

Karakteristik Responden Berdasarkan Usia

Berdasarkan hasil kuesioner, didapat data karakteristik responden berdasarkan usia. Sebanyak 80% responden berusia antara 18-25 tahun. Ini berarti, kebanyakan responden tergolong usia muda. Sebanyak 13% responden berumur 26-35 tahun. Sebanyak 4% adalah responden dengan usia dibawah 18 tahun. Sebesar 3% adalah responden berumur diatas 35 tahun.

Karakteristik Responden Berdasarkan Pekerjaan

Berdasarkan hasil kuesioner, didapat data karakteristik responden berdasarkan pekerjaan. Kebanyakan responden adalah mahasiswa dan atau pelajar dengan persentase 71%. Ini berarti dari populasi yang kami teliti sebagian besar pengguna internet dan pengakses media sosial adalah mahasiswa dan atau pelajar. Sebesar 25% responden memiliki pekerjaan sebagai karyawan swasta.  Responden yang memiliki pekerjaan sebagai pegawai negeri sebesar 3% dan sisanya sebesar 1% memiliki pekerjaan lainnya.

Dari data yang kami dapatkan bahwa intensitas penggunaan internet oleh responden kami sebesar 55% menyatakan sangat sering menggunakan internet, dilanjutkan dengan responden sebesar 35% menyatakan sering menggunakan internet. Responden yang jarang menggunakan internet hanya sebesar 9%, dan tidak ada responden yang tidak pernah menggunakan internet. Data lainnya yang kami dapatkan dari hasil kuesioner yang kami sebarkan menyatakan kegiatan mengakses dan mencari informasi tentang airlines melalui internet menunjukan perbedaan yang relatif besar yaitu 88%  responden menyatakan pernah mengakses atau mencari informasi tentang airlines sedangkan 12% menyatakan tidak pernah mengakses atau mencari informasi. Data ini sesuai dengan penelitian kami bahwa penggunaan internet untuk pencarian informasi tentang airlines sangat sering dilakukan.

Menganalilis variable technology dari hasil pengolahan data untuk item pertanyaan ke-1, 2 dan 3 didapatkan data bahwa para responden sering mengakses internet dan pernah mencari informasi tentang airlnes menggunakan internet, serta akun sosial media yang digunakan oleh responden untuk mengakses informasi tentang airlines: Website airline adalah media terbanyak yang dipilih dan digunakan responden dengan persentase sebesar 80%. Twitter digunakan sebagai media sosial dimana responden menggunakan media ini untuk mengakses informasi tentang airlines dinyatakan dalam persentase 17%, sedangkan facebook digunakan oleh 3% responden.

Pencarian informasi melalui media sosial dinilai mudah dilakukan, hal ini dikarenakan media sosial sudah menjadi bagian dari gaya hidup masyarakat, terutama kalangan usia muda yang dengan mudah dapat mengakses melalui gadget yang dimiliki.

Menganalilis variabel people dari hasil pengolahan data untuk item pertanyaan ke-4 tentang pemberian informasi terkini oleh admin media sosial, pertanyaan 5 tentang respon admin, dan pertanyaan 8 tentang bahasa yang digunakan admin dalam menanggapi costumer didapatkan bahwa responden setuju admin social media selalu memberikan informasi terkini dan mampu menanggapi permasalahan, saran, dan keluhan costumer dan juga menggunakan bahasa yang sopan dengan masing-masing persentase melebihi 50%. Angka ini masuk dalam kategori baik.  Tetapi dari pertanyaan ke-6 dan 7 variabel people didapatkan bahwa sebesar 58% responden menyatakan admin tidak selalu merespon dan membalas pertanyaan dari costumer, juga sebesar 68% responden menyatakan bahwa admin lambat dalam membalas pertanyaan dari costumer. Hal ini berarti bahwa admin merespon dan menanggapi costumer walaupun tidak semua saran, pertanyaan, ataupun keluhan ditanggapi dengan cepat.

Menganalilis variabel process dari hasil pengolahan data untuk item pertanyaan ke-9, 10, dan 11 tentang penilaian penggunanaan media sosial, informasi yang dicari tentang airlines dan opini customertentang informasi yang berikan. Didapatkan hasil bahwa responden menilai media sosial merupakan media yang cukup efektif bagi airlines untuk memberikan informasi. Informasi yang paling banyak dicari oleh responden adalah : promo sebesar 51%, dilanjutkan dengan informasi tentang harga tiket dengan presentase 35%, jadwal dan rute sebesar 14%.  Responden menilai bahwa informasi yang diberikan melalui media sosial sangat membantu, hal ini ditunjukkan dengan adanya prosentase sebesar 90%.

Kolerasi antara variabel people, process dan technology

Dari hasil yang kami kumpulkan, terlihat bahwa terdapat hubungan antara people, process dan technology. Hal itu terlihat dari respon yang baik dari admin melalui media sosial dapat mempengaruhi keputusan customer untuk melakukan pembelian dan menjadikan airlines tersebut sebagai preferensi customer. Penggunaan technology; internet dan media sosial yang mudah diakses melalui gadget membuat customer lebih mudah dalam melakukan pencarian informasi tentang airlines. Walaupun dengan data sebesar 59% responden tidak melakukan pencarian informasi secara berkala, namun sebesar 61% responden melakukan pembelian dan 67% menjadikan airlines tersebut sebagai preferensi.

Keputusan melakukan pembelian

Keputusan menjadikan airline sebagai preferensi

Sehingga dapat dilihat bahwa ketiga variable tersebut saling berhubungan antara satu dan lainnya dan memberikan pengaruh kepada keputusan konsumen dalam melakukan pembelian yang berdampak dengan timbulnya loyalitas pelanggan.

APAKAH FSC (FULL SERVICE CARRIER) KURANG DIMINATI DENGAN HADIRNYA LCC (LOW COST CARRIER)? (PART I) (REV.02)


Kelompok : 1 (Tugas 1)

Ketua :

Netty Yuliarti 224110176

Anggota :

Elparida Arni Basayanthy 224110133

Claudia Kartika Cahyati 224110163

Kelas : S1 ZU10

PENDAHULUAN

Sekarang ini LCC memang sedang booming di kalangan pengguna transportasi udara. Disamping harga tiket yang murah namun tetap mengutamakan aspek keselamatan merupakan pertimbangan mengapa LCC sangat diminati oleh masyarakat. Meskipun dalam LCC hanya disajikan pelayanan yang minimalis, hal ini tidak menjadi kendala bagi masyarakat untuk menggunakan layanan LCC.

Namun bukan berarti dengan adanya fenomena LCC, kemudian FSC (Full Service Carrier) menjadi tidak kedengaran gaungnya. Sebaliknya pertumbuhan bisnis penerbangan di Indonesia dengan layanan full service, belakangan ini meningkat. Banyak pemain-pemain baru yang mulai memasuki pasar full service yang selama ini hanya dikuasai oleh maskapai Garuda Indonesia. Sebut saja Pacific Royale Airways, merupakan maskapai swasta pertama di Indonesia yang melayani full-service yang telah melakukan debut terbangnya di beberapa kota pada 11 Juni 2012.

Meskipun layanan LCC cenderung menguasai pasar penerbangan Indonesia, namun eksistensi FSC masih terlihat. Indonesia National Air Carriers Association (INACA) atau Asosiasi Perusahaan Penerbangan Sipil Indonesia menyatakan kelas FSC memang hanya memegang porsi yang lebih kecil yakni hanya 20% pasar penerbangan Indonesia, sisanya 80% dikuasai pasar LCC. Namun jika maskapai full service tetap konsisten dalam pelayanan prima, pasarnya tetap masih ada.

Oleh karena itu, kami melakukan penelitian mengenai eksistensi maskapai full service di tengah gempuran penerbangan berbiaya rendah (LCC) ini bertujuan untuk meninjau bagaimana minat masyarakat terhadap penerbangan full service, apakah minat itu berkurang seiring semakin maraknya LCC, atau justru FSC memiliki pasarnya tersendiri sehingga gaungnya masih terdengar.

Sumber : http://travel.detik.com/read/2012/06/07/073202/1934929/1025/mulai-terbang-11-juni-pacific-royale-siap-gaet-traveler

http://www.bisnis.com/articles/pemain-full-service-pasar-penerbangan-bertambah

IS FSC LESS ENTHUSED BY THE PRESENCE OF LCC ?


Group: 1 (Task 1-5)
Leader:
Netty Yuliarti 224110176
Members:
Elparida Arni Basayanthy 224110133

Claudia Kartika Cahyati 224110163

Class: S1 MTU – ZU10

INTRODUCTION

 

Nowadays LCC is booming among the users of air transportation. Besides the ticket price is cheap but still give priority to the safety aspects are reasons why LCC is in great demand by the public. Although the LCC presented only minimal services, it is not become an obstacle for people to use LCC.

But that does not mean, Baca lebih lanjut

The Cause of Delay In The Flight


(224110041) Yusnita Desmawari Putri
(224110212) Natasha Octora
Grade: S1 MTU A – 2010

Conclusion
So the conclusion of our theme is “The Cause of Delay In The Flight” is that the many factors that can cause a delay in the flight. Factors causing delay include: technical, operational, weather and more. But the significant thing is known by many of the service users are external factors (weather) which is likely to cause delays and even failed to fly.

Suggestion
The airline industry is very influential on the country’s economy. Many people use air transport because transportation is very effective and efficient as shorten travel time. Thus, airlines should be optimized once in improving its performance.

The Cause of Delay In The Flight


(224110051) Yusnita Desmawari Putri
(224110212) Natasha Octora
Grade: S1 MTU A – 2010

Analysis
In our fourth article, we will explain about our analysis of the cause of the delay of a flight consisting of several factors.
We analyze our research method based on an online survey that we did that the cause of flight delays come from internal factors, namely technical constraints, constraints oprasional and time slot. Also external factors weather.
Most of our respondents chose that which causes flight delays are caused by external factors (weather) and some of them chose to internal factors as the reason.
For more details, please open the following link: http://www.surveyonics.com/surveyflow/keterlambatan-pesawat/10969

The Cause of Delay In The Flight


(224110051) Yusnita Desmawari Putri
(224110212) Natasha Octora
Grade: S1 MTU A – 2010

“Research Methods”
In our third article, we will conduct research method based on the title of our paper is “The Cause of Delay In The Flight”. To obtain data about the title, we use the descriptive research method.
In collecting the data, we use the internet is to do an online survey and literature review. Here’s the link we use to conduct online surveys and magazines

http://www.surveyonics.com/surveyflow/keterlambatan-pesawat/10969 and “TRANSPORT Magazine” as our literature in collecting data.
The survey we are doing by asking questions about the factors in a delay of the flight.
Target respondents of the online survey is approximately 35 people who we think enough for us to analyze our writing.
Similarly, the research method we can write.

The Cause of Delay In The Flight


(224110051) Yusnita Desmawari Putri
(224110212) Natasha Octora
Grade: S1 MTU A – 2010

Basis Theory
In our second article, we take the theoretical basis of the title of our paper is “The cause of the delay in the Flight” from several sources that we get from magazines and Law.
Here is the cause of the delay of a flight that we get from magazines “TRANSPORT Vol. No. 28. 1, June 2010 “are:
1. Ramp Handling
That delay in performing load cargo and postal packaging, hygiene inaccuracies aircraft handling time, charging or disposal of fuel is enough to occupy a lot of time, and delays in handling catering for passengers.
2. Terminal Handling
That delay in check-in process, handling the grouping passengers, and baggage handling.
3. Operational Handling
That is the problem with the flight documents.
4. Technical Problem
That is the damage to the aircraft or replacement of aircraft for some technical reasons.
5. External
That weather issues or problems with the immigration and customs.

Next, here are the other sources we have obtained from the Law Decree No. 1 of 2009 Chapter 1 Article 1 of the Flight Delay. Containing “Delay in Flight is the time difference between the time of departure or arrival time of departure or arrival realization.

The Cause of Delay In The Flight


(224110051) Yusnita Desmawari Putri
(224110212) Natasha Octora
Grade: S1 MTU A – 2010

Preliminary
The main products of the company or the airlines is to provide passenger and goods transportation services are fast, secure, and comfortable. The performance of  the airlines can be seen from the three main aspects of safety and security, timeliness, and service. Of these three aspects, in general airlines in Indonesia has not shown his best quality, most still in the unfavorable category. The low quality of aviation safety and security in Indonesia, marked by a high number of accidents.
So also with the things that should go together ie flight punctuality and service levels to be less attention. Specifically flight punctuality problems. The purpose of this research is to find out what are the factors that cause delays flights in Indonesia and the reasons for flight delays.
Flight punctuality is one of the main products of the airlines can be a benchmark of professionalism of the airlines, its users, the government and its rivals. Airlines is a business that is very sensitive to the image, when the airlines are experiencing delays departure, the negative image will be attached to the minds of its service users.
For example, the reason why many users choose the services of domestic flight services? because passengers usually only see in terms of affordable ticket prices, flight schedules that fit, and comfort in flight. Even in terms of timeliness was not a major reason. Therefore, the performance of the airline in terms of domestic flights punctuality still does not meet consumer expectations.

JATUHNYA PESAWAT SHUKOI SUPERJET 100


NAMA: BIMANTARA M.A
NIM: 224110337
KELAS: MTU-A
KESIMPULAN DAN SARAN
Saya mengambil kesimpulan bahwa Pesawat Shukoi Super Jet 100 adalah Pesawat yang CANGGIH dan Efisien .karena Pesawat ini sudah dibuat dengan Teknologi yang canggih dari mulai Body Pesawat,Mesin Pesawat,Tempat duduk yang aman dan bagus, serta Pesawat buatan Russia yang BARU.dalam kejadian jatuhnya pesawat shukoi super jet 100 di INDONESIA .saya menyimpulkan,Pesawat dengan teknologi ccanggih belum tentu SAFETY .semua tergantung kepada TUHAN yang berkehendak.

JATUHNYA PESAWAT SHUKOI SUPERJET 100


NAMA: BIMANTARA M.A
NIM: 224110337
KELAS: MTU-A

SURVEY
Pada bab 4 ini, saya telah melakukan survey tentang terjadinya Insiden Pesawat Shukoi Shukoi Super Jet 100. Pesawat shukoi super jet 100 jatuh pada tanggal 9 mei 2012,tepatnya di bogor jawa barat. Menurut masyarakat, pesawat shukoi super jet 100 jatuh karena kelalaian pilot. KNKT (komite nasional keselamatan transportasi) bependapat “Hasil investigasi KNKT dengan berbagai pihak terhadap jatuhnya pesawat Sukhoi adalah dalam rangka meningkatkan safety dan agar tidak terulang lagi pada masa yang akan datang,” kata Ketua KNKT Tatang Kurniadi dalam keterangan pers di Gedung KNKT, Jakarta, Selasa.
Kesebelas temuan KNKT yang menjadi fakta di balik Tragedi Sukhoi Superjet 100 itu adalah:

1. Penerbangan sudah direncanakan dalam Aturan Instrumen Penerbangan atau IFR
2. Rute penerbangan direncanakan bukanlah rute udara resmi yang diterbitkan
3. Rute minimum (MORA) untuk rute penerbangan yang direncanakan adalah 13.200 kaki
4. Ketinggian Aman Minimum (MSA) dari Lanud Halim Perdanakusuma adalah 6.900 kaki, sementara radius MSA itu adalah 25 Nautical Mile (NM) dari Halim
5. Ketinggian penerbangan adalah 10.000 kaki
6. Awak pesawat meminta menurunkan pesawat ke ketinggian 6.000 kaki dan menara kontrol mengizinkan turun ke posisi 6.000 kaki itu
7. Penerbangan meminta orbit ke kanan pada ketinggian 6.000 kaki dan disetujui Menara kontrol
8. Ketika layar radar menunjukkan pesawat meminta orbit, posisinya sudah berada di atas area Pelatihan Sanjaya Atang
9. Kawasan Atang Sanjaya berada sekitar 17 nautical mile (NM) barat daya dari Halim Perdanakusuma
10. Pesawat menabrak daratan pada arah 198 derajat dari Halim Perdanakusumah pada jarak 28 Nm, sementara ketinggian sekitar 6.000 kaki
11. Data para awak dan penumpang berada di dalam pesawat. Salinan manifes penumpang dan awak tidak tersedia di lembaga Ground Handling.

JATUHNYA PESAWAT SHUKOI SUPERJET 100


NAMA: BIMANTARA M.A
NIM: 224110337
KELAS: MTU-A
QUESTIONER
1. Apa penyebab terjadinya pesawat shukoi?
Menurut para penumpang penyebabnya karena pesawat yang sedang melakukan “Joy Flight” dalam rangka promosi kecanggihan teknologi pesawat Rusia itu banyak bermunculan baik di media cetak maupun elektronik dari berbagai sumber terutama para ahli penerbangan baik dari dalam maupun luar negeri.
2. Kapan terjadinya pesawat Shukoi jatuh?
Pesawat Shukoi Super Jet 100 yang jatuh pada tanggal 9 Mei 2011 di Puncak Gunung Salak II Bogor Jawa Barat sempat menewaskan seluruh penumpang dan kru pesawat tersebut menyisakan duka yang mendalam bagi banyak orang terutama keluarga para korban.
3. Mengapa Pesawat Shukoi bisa terjatuh?
Karena pilot pesawat shukoi telah terjadi kehilangan kontak dengan ATC(Air Traffic Control) disebabkan karena adanya gangguan sinyal yang tidak terhubung dengan pihak ATC.
4. Berapa banyak korban kematian yang terjadi pada kecelakaan tersebut/
Hampir semua awak pesawat Shukoi Super Jet 100 meninggal dunia

IS FSC LESS ENTHUSED BY THE PRESENCE OF LCC ? Part V. Conclusion


Group: 1 (Task 5)
Chairman:
Netti Yuliarti (2241.10.176)
members:
Elparida Arni B (2241.10.133)
Claudia Kartika C (2241.10.163)
Class: S1 ZU10

 

CONCLUSION

After we conducted a series of surveys both online and offline, from the questions that we asked in the questionnaire, we can measure the level of air passenger preferences based on the answers they provide, including:

1. choosing to use the Full Service Carrier 25 people = 48%

Consists of:

– Businessman = 5 people

– Office workers = 15 people

– Lecturer = 3 people

– More = 2 people

By reason of traveling, as follows:

– Business travel = 5 people

– Others (official) = 15 people

– Reason families = 5 people

2. Choosing to use the Low Cost Carrier by 27 people = 52%

Consists of:

– Students = 22 people

– Other = 5 people

By reason of traveling, as follows:

– Vacationing = 20 people

– The reason the family = 7 people

We can draw the conclusion that passengers using the service of Low Cost Carrier, more than the passengers using the service of Full Service Carrier, but this does not mean that the public interest is reduced to this Full Services . But due to the emergence of Low Cost Carrier services system, airlines who operating in the Full Service Carrier, mapping their own market segments which are identified most coming from the businessmen community and office workers. This shows that the Full Service Carrier does have its own market. They tend to sell to the passengers themselves who choose to use business-class flights with various reasons such as prestige, range of services, convenience of flying, safety that is more assured, and so forth.

ADVICE/SUGGESTIONS

  • For Communities who use air transportation.

The public should elect the flying services that will be used is not based on the price of expensive tickets or cheap, but it should give priority to the need for safety of flight. Due to aviation safety is the most important thing. In addition, before using the services of an airline, whether full service airlines and low-cost airlines, consumers should find out as much as whether the airline in question has a good reputation in the eyes of its customers or otherwise. Because of the high and low price of the ticket does not guarantee the satisfaction gained by consumers.

  • For Full Service Airlines.

Companies must maintain the quality of service provided. Due to the quality of service is a priority of full service airlines, especially in the service of each touch point must be considered in detail as Full Fare Airline communicate directly with consumers. Because if it is seen from the results of questionnaires that have been filled, the community has agreed that service quality full flight fare well. This is an opportunity for companies to continuously improve customer satisfaction and loyalty.

 

IS FSC LESS ENTHUSED BY THE PRESENCE OF LCC ? Part IV. Survey Report


Group: 1 (Task 4)
Chairman:
Netti Yuliarti (2241.10.176)
members:
Elparida Arni B (2241.10.133)
Claudia Kartika C (2241.10.163)
Class: S1 ZU10

SURVEY REPORT

                 We have made a survey conducted by distributing questionnaires in the form of structured and unstructured questionnaires. In a structured questionnaire, the questions asked by some alternative answers (multiple choice) that have been determined by us. The questionnaire was distributed online. Baca lebih lanjut

IS FSC LESS ENTHUSED BY THE PRESENCE OF LCC ? Part III. Research Methodology


Group: 1 (Task 3)
Chairman:
Netti Yuliarti (2241.10.176)
members:
Elparida Arni B (2241.10.133)
Claudia Kartika C (2241.10.163)
Class: S1 ZU10

 

RESEARCH METHODOLOGY

 

The more widespread use of the concept of LCC (Low Cost Carier) by airline companies in Indonesia to make the concept of FSC (Full Service Carier) seemed a bit knocked out so we decided to examine the “DO FSC less attractive with the presence of LCCs? ‘. Regarding the background and the theoretical basis we have explained in previous studies. We will continue this research to develop a questionnaire to support the needs of data for research next.

Baca lebih lanjut

IS FSC LESS ENTHUSED BY THE PRESENCE OF LCC ? Part II. Theoretical


Group: 1 (Task 2)
Chairman:
Netti Yuliarti (2241.10.176)
members:
Elparida Arni B (2241.10.133)
Claudia Kartika C (2241.10.163)
Class: S1 ZU10

THEORETICAL

The increasing demand of air transportation cause not only the upper class that requires this type transportation. The rise of the implementation strategy of the Low Cost Carrier aims to reach almost the entire community. Thus, the full service airline to be a bit marginalized. But if it remains consistent full-service market will still be there. According to the surveys we’ve done, here are some of the basic theory underlying the full service airlines:

Baca lebih lanjut

IS FSC LESS ENTHUSED BY THE PRESENCE OF LCC ? Part I. Introduction


Group: 1 (Task 1)
Chairman:
Netti Yuliarti (2241.10.176)
members:
Elparida Arni B (2241.10.133)
Claudia Kartika C (2241.10.163)
Class: S1 ZU10

 

INTRODUCTION

 

Nowadays LCC is booming among the users of air transportation. Besides the ticket price is cheap but still give priority to the safety aspects are reasons why LCC is in great demand by the public. Although the LCC presented only minimal services, it is not become an obstacle for people to use LCC.

 

Baca lebih lanjut

Penyebab dari Keterlambatan Suatu Penerbangan


Nama: (224110041) Yusnita Desmawari Putri

Anggota : (224110212) Natasya Octora

Kelas : S1 MTU A – 2010

 

Kesimpulan

Jadi kesimpulan dari tema kami yaitu “Penyebab dari Keterlambatan Suatu Penerbangan” adalah bahwa banyak sekali faktor yang dapat menyebabkan suatu keterlambatan dalam suatu penerbangan. Faktor yang menyebabkan keterlambatan antara lain: teknik, operasional, cuaca dan lain-lain. Tetapi hal yang sangat signifikan yang diketahui oleh banyak dari pengguna jasa adalah faktor eksternal (cuaca) yang banyak menyebabkan terjadinya keterlambatan bahkan gagal terbang.

 

Saran

Industri penerbangan sangat berpengaruh terhadap perekonomian negara. Banyak masyarakat menggunakan jasa angkutan udara karena, moda transportasi ini sangatlah efektif dan efisien karena mempersingkat waktu perjalanan. Dengan demikian, maskapai penerbangan harus lebih optimal sekali dalam meningkatkan kinerjanya.

Penyebab dari Keterlambatan Suatu Penerbangan


Nama : (224110051) Yusnita Desmawari Putri

Anggota : (224110212) Natasya Octora

Kelas : S1 MTU A – 2010

 

Analisa

Dalam tulisan kami yang keempat ini, kami akan menjelaskan mengenai analisa kami terhadap penyebab dari keterlambatan suatu penerbangan yang terdiri dari beberapa faktor.

Kami menganalisa dari metode penelitian kami berdasarkan survey online yang kami lakukan bahwa penyebab dari keterlambatan penerbangan berasal dari faktor-faktor internal yaitu kendala teknis, kendala oprasional dan slot time. Juga faktor eksternal cuaca.

Kebanyakan dari responden kami memilih bahwa yg menyebabkan terjadinya keterlambatan penerbangan adalah disebabkan oleh faktor eksternal (cuaca) dan beberapa diantaranya memilih faktor internal sebagai alasannya.

Untuk lebih jelasnya silahkan anda membuka link berikut : http://www.surveyonics.com/surveyflow/keterlambatan-pesawat/10969

 

Penyebab dari Keterlambatan suatu Penerbangan


Ketua : (224110051) Yusnita Desmawari Putri

Anggota : (224110212) Natasya Octora

Kelas : S1 MTU A – 2010

Metode Penelitian”

Dalam tulisan kami yang ketiga ini, kami akan melakukan metode penelitian berdasarkan judul dari tulisan kami yaitu “Penyebab dari Keterlambatan Suatu Penerbangan”. Untuk memperoleh data tentang judul kami, kami menggunakan metode penelitian deskriptif.

Dalam pengumpulan data, kami menggunakan media internet yaitu dengan melakukan survey online dan kajian pustaka. Berikut link yang kami gunakan dalam melakukan survey online http://www.surveyonics.com/surveyflow/keterlambatan-pesawat/10969 dan majalah “TRANSPOR” sebagai kajian pustaka kami dalam mengumpulkan data.

Survey tersebut kami lakukan dengan memberikan pertanyaan mengenai faktor-faktor terjadinya keterlambatan penerbangan.

Target responden dari survey online kami kurang lebih sekitar 35 orang yang kami rasa cukup untuk kami dalam melakukan analisa tulisan kami.

Demikian metode penelitian yang dapat kami tuliskan.

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 5)


Kelompok      : 10

Ketua                :  Rahmadya Karisma Haris (224110327)

–          Veronica (224110019)

–          Meyta Rezky S (224110101)

–          Sherly Septirani (224110224)

Kelas              :  ZU10

KESIMPULAN

Dari hasil survey yang kami dapatkan, kami menarik kesimpulan bahwa masyarakat menjadikan airlines yang menggunakan media sosial sebagai preferensinya. Hal ini dikarenakan adanya pemberian informasi yang rutin melalui media sosial yang membuat mayoritas costumer dapat mengakses media sosial dengan mudah, merasa bahwa pemberian informasi ini sangat membantu mereka dalam mengetahui informasi terbaru, baik itu mengenai promo ataupun jadwal penerbangan meskipun masyarakat tidak selalu mencari informasi secara berkala namun masyarakat secara umum tetap melakukan pembelian.

Selain itu, walaupun respon admin tidak cepat dalam menganggapi permasalahan dan tidak selalu membalas input yang disampaikan oleh customer, pemberian informasi dari airlines melalui media sosial mempengaruhi Baca lebih lanjut

PENGARUH E-TICKET TERHADAP EKSISTENSI CALO TIKET DI BANDARA


Kelompok 6

Ketua             :           Fitriyanti                                 224110100

Anggota         :          Rantih Lenggo Geni            224110018

Indah Nurbaiti                      224110196

Mentari de tanzil                  224110102

Kelas              :           ZU 2010

Tugas             :           5

KESIMPULAN DAN SARAN

Kesimpulan

Selama kurang lebih 2 minggu kami melakukan survey online, dan melakukan wawancara langsung terhadap para calo yang ada di Bandara Soekarno Hatta tepatnya diterminal 1C. Setelah itu kami menganalisis data yang kami dapat. Pertanyaan yang dapat mewakili kesimpulan kami yaitu:

Dari 72 responden yang menjawab pertanyaan kami  sebanyak 62 orang yang mengatakan kalau mereka tidak pernah membeli tiket melalui calo dan sebanyak 10 orang yang menyatakan kalau mereka pernah membeli tiket melalui calo.

Dan sebanyak 64 orang yang menyatakan bahwa mereka  tahu mengenai pemberlakuan mengenai e-ticket dan sebanyak 8 orang yang menyatakan tidak tahu mengenai e-ticket. Kami pun dapat menyimpulkan:

Ä   Hanya sebagian orang yang lebih memilih membeli tiket melalui calo. Rata-rata orang-orang tersebut memang tidak suka dengan prosedur yang ada di dalam e-ticket yang membingungkan dan tidak ada waktu untuk melakukan reservasi secara langsung ke pihak airline, atau mereka sedang terburu-buru ingin melakukan penerbangan sehingga membeli tiket melalui calo.

Ä   Keberadaan akan adanya calo tiket memang mengganggu ketertiban yang ada di bandara. Akan tetapi sebaiknya kita tidak terlalu berfikir negatif terhadap profesi calo tersebut. Bukan salah mereka  apabila mereka menjadi calo tapi karena kebutuhan hidup yang makin lama makin susah dalam pemenuhannya. Transaksi yang mereka lakukan tidak bersifat memaksa.

Ä   Pada tanggal 1 Juni 2009 IATA telah memberitahukan kepada setiap perusahaan penerbangan yang menjadi anggotanya untuk memberlakukan e-ticket dalam semua transaksi. Hal tersebut tentu akan lebih memudahkan para konsumen dalam memesan tiket. Karena calon penumpang tidak perlu mengunjungi secara langsung counter airlines. Dengan adanya hal tersebut  para penumpang nantinya akan lebih memilih memesan melalui e-ticket dari pada melalui calo.

Saran

Ä   Untuk para pengguna jasa penerbangan

Apabila akan melakukan penerbangan diharapkan untuk membeli tiket  dengan pemesanan secara langsung ke counter airlines atau melalui travel agent. Jangan membeli tiket melalui calo, harga yang ditawarkan relatif lebih mahal dari harga yang sebenarnya dan tidak terjamin dalam hal asuransi apabila terjadi suatu kejadian. Berbeda dengan membeli tiket melalui counter resmi airlines, travel agent atau memesan melalui e-ticket.

Ä   Untuk para calo tiket

Pekerjaan yang mereka lakukan sebenarnya tidak merugikan pihak konsumen. Pada saat-saat tertentu memang para konsumen membutuhkan calo tiket. Transaksi yang mereka lakukan tidak bersifat memaksa konsumen. Namun setidaknya apabila masih bisa mendapatkan pekerjaan yang lebih tetap itu akan lebih baik. Atau beralih profesi dari calo tiket kemudian membuat travel agent, tentu hal tersebut akan lebih berguna.

Ä   Untuk pihak keamanan yang ada di bandara

Keberadaan para calo memang bersifat ilegal dan melanggar peraturan. Seharusnya pihak keamanan yang ada di bandara melakukan sweeping secara rutin. Tidak hanya menasehati calo yang tertangkap apabila sedang melakukan transaksi akan tetapi memberikan penyuluhan agar mereka jera. Bagaimanapun dengan adanya keberadaan calo akan memperburuk citra sistem keamanan yang ada.

Tanggapan Masyarakat Mengenai Konsep Lowcost Carriers (LCCs) (kesimpulan dan saran)


Nama Kelompok :

Ketua :           Dimas Satrio Putra Gunawan (224108210)
Anggota :       1. Mentari Noor (224110251)

Kelas :            S1 MTU-A

Tugas :           5 (Kesimpulan dan Saran)

 

KESIMPULAN

Berdasarkan hasil  survey yang telah kami buat sebelumnya yag berisi mengenai pertanyaan-pertanyaan, salah satunya  : Baca lebih lanjut

APAKAH FSC KURANG DIMINATI DENGAN HADIRNYA LCC? (PART 4)


Kelompok : 1

Ketua :

Netti Yuliarti (2241.10.176)

Anggota :

Elparida Arni B (2241.10.133)

Claudia Kartika C (2241.10.163)

Kelas : S1 ZU10

Tugas : 4

LAPORAN HASIL SURVEY

                Kami telah membuat suatu survei yang dilakukan dengan cara menyebarkan kuesioner dalam bentuk kuesioner terstruktur dan tidak terstruktur. Pada kuesioner yang tersruktur, pertanyaan-pertanyaan diajukan dengan beberapa jawaban alternatif (pilihan ganda) yang telah ditentukan oleh kami. Kuesioner ini disebar secara online. Sedangkan pada kuesioner yang tidak terstruktur, pertanyaan-pertanyaan dibuat dalam bentuk essay, responden dituntut untuk mendeskripsikan pemikirannya dalam menjawab pertanyaan kuesioner. Dan kuesioner ini disebar secara offline. Bentuk data yang kami himpun adalah data kualitatif, yakni yang berbentuk kata atau kalimat berupa pertanyaan-pertanyaan yang memerlukan jawaban. Survey ini dibuat untuk menganalisis permasalahan komparatif yang sifatnya membandingkan bagaimana minat masyarakat terhadap 2 (dua) jenis layanan penerbangan, yaitu Full Service Carrier dan Low Cost Carrier. Total responden yang kami dapat adalah sebanyak 52 responden. Kami melakukan penyebaran kuesioner sejak 2 oktober 2012 hingga 11 oktober 2012.

Di bawah ini merupakan hasil dari survey yang kami lakukan :

Kelompok Responden :

Alasan melakukan perjalanan dan frekuensi perjalanan :

Penanggungan Biaya Perjalanan :

Minat terhadap layanan penerbangan :

ANALISIS DATA

                Dari data-data yang telah kami sebutkan di atas, kami akan membuat suatu analisis yang bertujuan untuk mengetahui bagaimana minat masyarakat terhadap layanan Full Service Carrier dengan banyak bermunculannya Low Cost Carrier serta apa yang mendasari dari minat tersebut.

                Kami menganalisis bahwa, setelah banyak bermunculannya airline-airline baru dengan konsep Low Cost Carrier atau penerbangan berbiaya murah, banyak masyarakat yang memang beralih untuk menggunakan layanan tersebut, tetapi banyak pula golongan masyarakat tertentu yang tetap setia menggunakan layanan Full Service Carrier. Faktor-faktor yang mendasari hal tersebut menurut data kami diantaranya waktu perjalanan, motif perjalanan, serta penanggungan biaya perjalanan. Berikut ulasan analisis kami:

                Jika kita ingin menggunakan layanan terbang Low Cost Carrier, kita harus melakukan pemesanan dari beberapa bulan sebelum melakukan perjalanan. Jika waktu perjalanan dilakukan secara mendadak, maka kita tidak akan bisa melakukan pembelian terhadap layanan tersebut. Karena maskapai penerbangan bertarif rendah sangat mengandalkan strategi promosi mereka jauh-jauh hari sebelum jadwal penerbangan dilakukan, biasanya dalam kurun waktu 3-6 bulan sebelumnya. Semakin dekat dengan hari keberangkatan maka harga tiket akan semakin mahal. Oleh karena itu, golongan masyarakat yang cenderung menggunakan layanan terbang Low Cost Carrier kebanyakan dari kalangan mahasiswa, yang melakukan motif perjalanan untuk liburan yang terencana. Karena liburan tersebut telah direncanakan beberapa bulan sebelumnya, sehingga mereka akan melakukan pembelian minimal 3 bulan sebelum mengadakan perjalanan, dan harga tiket akan cenderung murah. Hal ini juga didasari oleh keterbatasan biaya yang dimiliki oleh mahasiswa tersebut. Mereka cenderung tidak memikirkan jenis layanan apa yang dapat mereka terima, yang terpenting layanan dasar (destinasi/tujuan) dapat terpenuhi. Sedangkan pebisnis cenderung tetap menggunakan layanan Full Service Carrier, karena para pebisnis akan melakukan perjalanan sesuai dengan jadwal bisnisnya yang terkadang sifatnya mendadak atau tidak bisa direncanakan jauh-jauh hari. Sehingga mereka tidak akan merasa keberatan untuk membayar layanan Full Fare yang mahal. Selain itu dengan jadwal bisnis yang padat akan membuat frekuensi penerbangan mereka juga padat. Dengan frekuensi penerbangan yang padat, pebisnis akan lebih puas untuk menggunakan Full Service Carrier, karena kualitas layanan yang diberikan akan lebih baik dan lebih banyak, sehingga penerbangan mereka akan lebih menyenangkan dan dapat mengurangi tingkat stres mereka akibat padatnya jadwal bisnis. Pada masyarakat yang melakukan perjalanan dengan transportasi udara untuk alasan keluarga, apabila motif perjalanan tersebut timbul akibat dari suatu kejadian darurat yang sifatnya mendadak seperti ada sanak keluarga yang sakit atau meninggal, maka mereka cenderung akan menggunakan layanan terbang Full Service Carrier. Tetapi apabila kunjungan keluarga tersebut dilakukan secara rutin, misalnya setiap hari raya lebaran atau beberapa bulan sekali, masyarakat golongan ini cenderung menggunakan Low Cost Carrier yang dapat dibeli 3-6 bulan sebelum melakukan perjalanan sehingga harganya akan lebih murah. Responden kami yang terakhir adalah golongan pekerja kantor yang melakukan perjalanan atas alasan dinas, yang waktunya dilakukan sesuai dengan ketentuan perusahaan atau instansi tempat mereka bekerja, sehingga waktu perjalanan tidak bisa direncanakan, oleh karena itu, mereka cenderung akan menggunakan layanan Full Service Carrier, selain itu alasan lain mereka menggunakan layanan terbang ini adalah, karena perjalanan dilakukan untuk dinas, maka biaya perjalanan akan ditanggung sepenuhnya oleh perusahaan atau instansi tempat mereka bekerja, sehingga mereka tidak akan berkeberatan untuk membayar mahal.

                Dari analisis tersebut, kami beranggapan meskipun banyak masyarakat yang beralih menggunakan layanan Low Cost Carrier, tetapi sesungguhnya minat masyarakat terhadap layanan Full Service Carrier tidak berkurang, hal ini tergantung dari tingkat kepentingan dari perjalanan yang mereka lakukan, keterbatasan dana yang dimiliki, dan waktu diadakannya perjalanan.

Maskapai Indonesia Dianggap Belum Aman oleh Dunia (Part 05)


Kelompok  : 1

Nama: Taufans rizkyanto                   : 224110121 (ketua)

Christophorus linggatantra  : 224110171

Albert parlindungan               : 224110126

Bahrul ulum                            : 224110293

Kelas : MTU-A

Tugas : 5

E. Kesimpulan.

Dari analisis diatas. Kelompok kami dapat mengambil kesimpulan bahwa pada dasarnya semua maskapai penerbangan baik itu untuk penerbangan domestik dan panerbangan internasional, disamping tujuan perusahaan mendapatkan keuntungan, perusahaan  penerbangan harus memperhatikan tingkat keamanan dan keselamatan penerbangan disetiap armada/ maskapai seperti pengecekan tekanan angin pada ban pesawat udara, rem, fuel (bahan bakar avtur), pengecekan mesin pesawat, pengecekan seatbealt (sabuk keselamatan), pengecekan pelampung darurat dan masker oksigen, dll. Dengan adanya pengecekan tersebut nantinya dapat diketahui jika ada kerusakan-kerusakan pada salah satu komponen-komponen dimaskapai tersebut. Saran dari kelompok kami supaya para maskapai penerbangan selain mendapatkan keuntungan, juaga harus memperhatikan keamanan dan keselamatan penerbangan.

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 4)


Kelompok      : 10

Ketua               :  Rahmadya Karisma Haris (224110327)

–          Veronica (224110019)

–          Meyta Rezky S (224110101)

–          Sherly Septirani (224110224)

Kelas               :  ZU10

ANALISIS

Karakteristik Responden Berdasarkan Jenis Kelamin

Berdasarkan hasil kuesioner, didapat data karakteristik responden berdasarkan jenis kelamin. Sebanyak 38% responden adalah pria, sementara 62% adalah wanita. Meskipun wanita lebih banyak, tapi gap persentase bisa dibilang tidak terlalu jauh.

Karakteristik Responden Berdasarkan Usia

Berdasarkan hasil kuesioner, didapat data karakteristik responden berdasarkan usia. Sebanyak 80% responden berusia antara 18-25 tahun. Ini berarti, kebanyakan responden tergolong usia muda. Sebanyak 13% responden berumur 26-35 tahun. Sebanyak 4% adalah responden dengan usia dibawah 18 tahun. Sebesar 3% adalah responden berumur diatas 35 tahun.

Karakteristik Responden Berdasarkan Pekerjaan

Berdasarkan hasil kuesioner, didapat data karakteristik responden berdasarkan pekerjaan. Kebanyakan responden adalah Baca lebih lanjut

PILOT LALAI, PENUMPANG LUNGLAI


Nama kelompok 9

Ketua :           – Diana Fatma Raininta (2241.10.308)

Anggota :     – Mia Rahmah (2241.10.329)

-Nita Nurjanah  (2241.10.313)

-Novi arista (2241.10.321)

Kelas : ZU-10

TUGAS 4

BAB IV

ANALISIS DATA

Setelah melakukan upaya pengumpulan data dengan menggunakan wawancara tertutup mengenai “Pilot Lalai, Penumpang Lunglai” dengan menggunakan 21 pertanyaan yang dipaparkan secara online melalui freeonlinesurvey.com, kami mendapatkan data sebanyak 30 responden, data ini disebarkan melalui facebook, twitter, maupun personal message, sehingga data dapat diperoleh dengan cepat dan tepat.

Data responden yang didapatkan :

-14% Responden merupakan laki-laki

-16% Responden yang mengisi merupakan mahasiswa/mahasiswi

-12% Umur Responden merupakan kisaran 20-30 tahun

Data jawaban yang didapat dari responden :

Setelah melakukan wawancara ini, ternyata banyak masyarakat yang menyimpulkan bahwa pada masa yang akan datang, pilot dalam negeri siap menerima kebijakan open sky yang akan dilaksanakan pada tahun 2015 mendatang. Hal ini cukup mengejutkan dikarenakan Baca lebih lanjut

Maskapai Indonesia Dianggap Belum Aman oleh Dunia (Part 04)


Kelompok  : 1

Nama: Taufans rizkyanto                   : 224110121 (ketua)

Christophorus linggatantra  : 224110171

Albert parlindungan               : 224110126

Bahrul ulum                            : 224110293

Kelas : MTU-A

Tugas : 4

D. Analisis

Dibab 4 ini kelompok kami menganalisis tentang data yang sudah kita dapat dari hasil survey offline dengan memberikan daftar kuesioner ke teman-teman kami, orang tua kami masing-masing, dan juga ohm & tante kami.hasilnya dari 40 lembar kusioner yang kami bagikan, hanya 35 lembar kuesioner yang terisi. Sisanya 5 lembar kuesioner tidak menjawab dengan alasan tidak pernah naik pesawat udara. Berikut adalah hasil kuesioner kami.


Berilah Check – list (ü) pada tabel pertanyaan dibawah ini:

No Pertanyaan SS S R TS STS
1 Maskapai Indonesia belum memenuhi standar keamanan dan keselamatan penerbangan internasional.   10      
2 Maskapai penerbangan Indonesia tidak peduli dengan keamanan dan keselamatan penumpang didalam pesawat.   5      
3 Maskapai penerbangan Indonesia sudah layak untuk terbang ke benua-benua eropa.       10  
4 Maskapai Indonesia sudah layak bersaing dengan  maskapai elit dibenua eropa dari segi keamanan dan keselamatan.       5  
5 Maskapai Indonesia adalah maskapai dengan tingkat keamanan dan keselamatan paling buruk didunia.   5      

 


Keterangan:

  1. 1.       SS:           Sangat Setuju.
  2. 2.       S   :           Setuju.
  3. 3.       R   :           Ragu – ragu.
  4. 4.       TS:           Tidak Setuju.
  5. 5.       STS:        Sangat Tidak Setuju

 

Baca lebih lanjut

Tanggapan Masyarakat Mengenai Low Cost Carriers (LCCs) (analisis)


Nama Kelompok :

Ketua :           Dimas Satrio Putra Gunawan (224108210)
Anggota :       1. Mentari Noor (224110251)

Kelas :            S1 MTU-A

Tugas :           4 (analisis)

Dari hasil data survey yang sudah kami buat dapat diketahui bahwa masih sebagian besar masyarakat Indonesia merasa tidak nyaman dengan pelayanan dari airlines yang menggunakan konsep low cost carrier, dan menurut masyarakat pesawat yang menggunakan konsep low cost carrier masih belum bisa dikatakan aman. Hal ini menjadi PR besar bagi perusahaan penerbangan tersebut untuk membuat pelanggan menjadi nyaman, aman dan loyal

ANALISIS Baca lebih lanjut

Maskapai Indonesia Dianggap Belum Aman oleh Dunia (Part 03)


Kelompok  : 1

Nama: Taufans rizkyanto                   : 224110121 (ketua)

Christophorus linggatantra  : 224110171

Albert parlindungan               : 224110126

Bahrul ulum                            : 224110293

Kelas : MTU-A

Tugas : 3

C. Metode Penelitian.

Dalam metode penelitian ini, kelompok kami menggunakan metode pengumpulan data yang merupakan bagian dari urutan dalam sistematika untuk memperoleh data premier yaitu sumber data yang langsung berasal dari sumbernya. Data sekunder adalah data yang tidak berasal dari usaha sendiri tetapi melakukan penelitian melalui pengumpulan data dengan cara melakukan penelitian keperpustakaan, dari surat kabar seperti koran dan bisa juga melalui internet.

Pada dasarnya metode penelitian dibuat supaya pada saat pelaksanaannya dapat berjalan dengan lancar, sehingga metode penelitian dapat tercapai secara sistematis dan sesuai dengan yang kita harapkan. Pembuatan metode penelitian ini berdasarkan judul dari tugas kami yaitu Maskapai Indonesia Dianggap Belum Aman oleh Dunia. Adapun tahap-tahap dalam mengidentifikasi dari permasalahan ini yaitu:

 

  1. Pengumpulan data.

Pada tahap ini, pengumpulan data diperlukan untuk mendukung penelitian terhadap judul dari karya tulis kelompok kami yaitu Maskapai Indonesia Dianggap Belum Aman oleh Dunia. Pengumpulan data kami bisa menemukannya diinternet, google, koran-koran. Pada tahap ini pengumpulan data ini kami sebut dengan data primer.

2.   Mengolah data.

Pada tahap ini, kami mengolah data-data yang kelompok kami temukan, kemudian dikembangkan menurut pemikiran dari kelompok kami. Pada tahap ini hasil dari pengolahan data kami sebut dengan data sekunder.

3.  Metode penelitian.

Pada tahap ini, kelompok kami menggunakan tabel kuesioner dengan cara foto copy tabel kuesioner lalu kami bagi-bagikan kepada teman-teman kami yang sering menggunakan pesawat udara sebagai sarana transportasi untuk berpergian saat liburan kuliah, libur lebaran, libur Natal dan Tahun Baru, dan juga orang tua kami masing-masing.

Selanjutnya kami juga membagikan tabel kuesioner kepada ohm dan tante kami yang kebetulan mereka sering menggunakan pesawat udara sebagai sarana transportasi untuk berlibur ke Eropa dan juga pada saat melakukan perjalanan dinas dari kantornya.

Baca lebih lanjut

APAKAH FSC KURANG DIMINATI DENGAN HADIRNYA LCC? (PART 3)


Kelompok : 1

Ketua :

Netti Yuliarti (2241.10.176)

Anggota :

Elparida Arni B (2241.10.133)

Claudia Kartika C (2241.10.163)

Kelas : S1 ZU10

 

METODOLOGI PENELITIAN

Semakin maraknya penggunaan konsep LCC (Low Cost Carier) oleh perusahaan-perusahaan penerbangan  di Indonesia membuat konsep FSC (Full Service Carier) terkesan agak tersingkir sehingga kami memutuskan untuk meneliti “APAKAH FSC KURANG DIMINATI DENGAN HADIRNYA LCC?”.  Mengenai latar belakang dan landasan teori telah kami jelaskan pada penelitian sebelumnya. Kami akan melanjutkan penelitian ini dengan Baca lebih lanjut

PILOT LALAI, PENUMPANG LUNGLAI


Nama kelompok 9

Ketua :             – Diana Fatma Raininta (2241.10.308)

Anggota :       – Mia Rahmah (2241.10.329)

-Nita Nurjanah  (2241.10.313)

-Novi arista (2241.10.321)

TUGAS 3

METODE PENELITIAN

            Pada bab ketiga dalam tugas karya tulis kami yang bertemakan “Pilot Lalai Penumpang Lunglai”, kami akan membuat suatu metode penelitian berdasarkan landasan teori yang telah kami buat sebelumnya.

Metode penelitian yang akan kami gunakan yaitu metode deskriptif kualitatif baik secara online dengan membuat instrumen kuesioner dan menyebarkannya kepada masyarakat luas melalui beberapa jejaring sosial, serta secara offline yaitu dengan melakukan wawancara dengan masyarakat secara langsung untuk mendapatkan sejumlah data yang kemudian diolah menjadi informasi.

Untuk memperoleh data tersebut kami melakukannya dengan menyebarkan sejumlah angket melalui media elektronik/jejaring sosial seperti facebook, twitter, blog, dan personal message. Cara lainnya untuk mendapatkan data adalah dengan melakukan Baca lebih lanjut

PENTINGKAH COMMERCIAL AREA YANG “MEWAH” BAGI SUATU BANDARA? (PART III)


Kelompok     :                                     8

Ketua               :

RIZKY INAYAH                                224110220

Anggota        :

NURSERY ALFARIDI                    224110046

SEKAR WIDYASTUTI                   224110045

NOVIA CAHYA SYAFITRI        224110225

Kelas                :                                        S1 ZU10

 

METODOLOGI PENELITIAN

Penelitian kami memiliki ruang lingkup penelitian yang berfokus pada penilaian seberapa penting area komersial yang dibangun mewah bagi bandar udara.

Dalam penelitian ini, kami memilih beberapa metodologi penelitian. Salah satunya adalah metode pengumpulan data. Metode tersebut menggunakan data primer yaitu dengan melakukan survei kepada para responden yang sering menggunakan area komersial di bandar udara. Data primer dalam hal ini adalah data yang diperoleh dari jawaban responden yang diteliti, yaitu berupa data mengenai pendapat atau fenomena dari obyek.

Selain itu, kami juga menggunakan metode penarikan sampel yang terdiri dari kuesioner dan dokumentasi. Kuesioner disebarkan secara online melalui docs.google.com atau tidak langsung, maupun offline  atau secara langsung. Sedangkan dokumentasi merupakan teknik pengumpulan data dengan cara melihat, membaca, mengamati dan mengolah data yang menunjang penelitian ini.

Metode lain yang kami gunakan adalah metode penelitian deskriptif. Metode ini bertujuan untuk menjelaskan pengaruh perkembangan commercial area  bagi suatu bandar udara yang dapat digunakan oleh bandar udara tersebut untuk memperoleh keuntungan. Cara tersebut dilakukan dengan cara merumuskan dan menafsirkan data sehingga dapat memberikan gambaran yang jelas mengenai penelitian yang kami lakukan.

 

 

 

Tanggapan Masyarakat Mengenai Low Cost Carrier (metode penelitian)


Nama Kelompok :

Ketua :           Dimas Satrio Putra Gunawan (224108210)
Anggota :       1. Mentari Noor (224110251)

2. Barkatullah (224110231)

Kelas :            S1 MTU-A

Tugas :           3

METODE PENELITIAN

Pada tugas minggu ini kelompok kami akan menentukan metode apa yang akan kami gunakan dalam  penelitian tugas yang sedang kami buat. Metode yang kami gunakan yaitu metode pengumpulan data mengenai hasil respon masyarakat tentang  low cost carrier. Sebelumnya kami akan menjelaskan pengertian dari data. Baca lebih lanjut

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 3)


Kelompok      : 10

Ketua             : Rahmadya Karisma Haris (224110327)

Anggota         : Veronica (224110019)

Meyta Rezky Setiorini (224110101)

Sherly Septirani (224110224)

Kelas              : S1-ZU-10

Metodologi Penelitian

Kami menggunakan metode penelitian dengan menyebar kuesioner dan wawancara langsung. Kuesioner dan wawancara langsung terstruktur yang dilakukan dalam penelitian ini dibuat dan dikembangkan berdasarkan variabel-variabel yang telah ditentukan seperti people, process dan technology. Kuesioner penelitian ini berisi tentang pertanyaan-pertanyaan yang juga akan mengidentifikasi seberapa signifikan variabel-variabel tersebut terhadap variabel dependen kami yaitu loyalitas pelanggan yang ditandai dengan pembelian berulang.

Target responden kami adalah Baca lebih lanjut

Penyebab dari Keterlambatan suatu Penerbangan


Ketua : (224110051) Yusnita Desmawari Putri

Anggota : (224110212) Natasya Octora

Kelas : S1 MTU A – 2010

 

Landasan Teori

Dalam tulisan kami yang kedua ini, kami mengambil landasan teori mengenai judul dari tulisan kami yaitu “ Penyebab dari Keterlambatan suatu Penerbangan” dari beberapa sumber yang kami peroleh dari majalah dan Undang-undang.

Berikut adalah penyebab terjadinya keterlambatan suatu penerbangan yang kami peroleh dari majalah “TRANSPOR Vol. 28 No. 1, Juni 2010” yaitu:

  1. Ramp Handling

Yaitu keterlambatan dalam melakukan pengemasan muatan kargo dan pos, ketidaktepatan waktu dalam penanganan kebersihan pesawat, pengisian atau pembuangan bahan bakar yang cukup menyita banyak waktu, dan keterlambatan dalam penanganan catering bagi para penumpang.

  1. Terminal Handling

Yaitu keterlambatan dalam proses check-in, penanganan dalam pengelompokan penumpang, dan penanganan bagasi.

  1. Operational Handling

Yaitu terjadinya masalah dengan dokumen penerbangan.

  1. Technical Problem

Yaitu terjadinya kerusakan pada pesawat atau penggantian pesawat karena suatu alasan teknis.

  1. Ekstern

Yaitu masalah cuaca atau masalah pada imigrasi dan pabean.

 

Selanjutnya, berikut adalah sumber yang lainnya yang kami peroleh dari Undang-undang yaitu UU RI nomor 1 Tahun 2009 Bab 1 Pasal 1 tentang Keterlambatan Penerbangan. Yang berisi “Keterlambatan dalam Penerbangan yaitu terjadinya perbedaan waktu antara waktu keberangkatan atau kedatangan dengan realisasi waktu keberangkatan atau kedatangan.

Demikian Landasan teori yang dapat kami tuliskan.

Penyebab dari Keterlambatan suatu Penerbangan (Rev 01)


Ketua    : (224110051) Yusnita Desmawari Putri

Anggota : (224110212) Natasya Octora

Kelas     : S1 MTU A – 2010

 

Pendahuluan

Produk utama dari perusahaan atau airlines adalah untuk menyediakan jasa angkutan penumpang dan barang yang cepat, aman, dan nyaman. Kinerja dari airlines dapat dilihat dari 3 aspek utama yaitu keselamatan dan keamanan, ketepatan waktu, dan pelayanan. Dari ketiga aspek tersebut, secara umum airlines di indonesia belum menunjukan kualitas terbaiknya, sebagian besar masih dalam kategori kurang baik. Masih rendahnya kualitas keselamatan dan keamanan penerbangan di Indonesia, ditandai dengan tingginya angka kecelakaan penerbangan. Baca lebih lanjut

KOMPENSASI YANG EHARUSNYA DIDAPAT PENUMPANG SAAT TERJADI DELAY ??


Pesawat nasional atau armada angkutan udara nasional selalu identik dengan kata DELAY yaitu pesawat yang mengalami keterlambatan keberangkatan atau kedatangan dari jadwal yang sudah ditentukan , keterlambatan tersebut tentunya membuat penumpang kecewa,karena keterlambatan tersebut membuat penumpang menghabiskan waktunya untuk menunggu.contohnya kerugian yang dialami penumpang : saat penumpang sedang mengejar waktu karna sanak keluarga meninggal atau terkena musibah , tetapi karena keterlambatan tersebut tidak dapat melihat jasad sanak sodaranya yang meninggal , lalu seorang pengusaha mengejar waktu ingin meeting dengan klien nya menjadi mundur waktunya atau telat , sehingga mengalami kerugian yang besar .kadang walaupun merasa rugi keterlambatan tersebut masi bisa ditolerir karna waktu keterlambatan masi singkat tapi kadang keterlambatan tersebut bisa sampai berjam – jam . banyak penyebab yang membuat terjadinya delay tersebut , contohnya :

1. kejadian yang tidak terduga , tidak dapat diperhitungkan , dan tidak dapat dielakan contohnya bencana alam , kondisi cuaca

2. pemeriksaan keamanan dalam pesawat karena adanya tamu VIP

3. kesalahan sistem pesawat atau teknis yang berhubungan dengan mesin pesawat

walaupun penyebab tersebut kadang masi bisa dimaklumi tetap saja penumpang mengalami keruugian , kerugian waktu sudah pasti , belum lagi kerugian materi dan kerugian yg bisa diganti karena keterlambatan tersebut , dari kerugian tersebut terdapat dalam pasal 10 pemenhub, disebutkan bahwa maskapai penerbangan yang mengalami keterlambatan lebih dari 4 jam wajib memberikan ganti rugi pada penumpang Rp.300.000 perpenumpang .apakah dengan ganti rugi 300.000 bisa menggantikan kerugian penumpang ?? seharusnya penumpang yang mengalami keterlambatan setengah jam diberikan makan , penumpang yang mengalami keterlamabatan lebih dari 1 jam atau lebih diberikan penginapan + tiket pesawat pengganti karena kepentingan orang kan berbeda – beda , dang banyak kemungkinan kerugian yang didapat itu fatal apabila dilihat dari kepentinganya , jadi apakah pasal 10 pemenhub tersebut bisa menggantikan kerugian penumpang ?? lalu apa kompensasi yang seharusnya layak didapat penumpaang saat mengalami delay ?

Maskapai Indonesia Dianggap Belum Aman oleh Dunia (Part 01) (Rev 01)


Kelompok  : 1

Nama: Taufans rizkyanto                   : 224110121 (ketua)

Christophorus linggatantra  : 224110171

Albert parlindungan               : 224110126

Bahrul ulum                            : 224110293

Kelas : MTU-A

Tugas:

B.   Landasan Teori

Sekarang kami akan memberikan landasan teori terhadap survey dari kelompok kami yang sedang berjalan bersamaan dengan tugas ini. Kami menggunakan buku UNDANG-UNDANG PENERBANGAN REPUBLIK INDONESIA NOMOR 1 TAHUN 2009 TENTANG PENERBANGAN, mengenai PERATURAN PEMERINTAH TENTANG KEAMANAN DAN KESELAMATAN PENERBANGAN, khususnya BAB I KETENTUAN UMUM Pasal 1 ayat 1sampai dengan 3 yaitu:

  1. Keamanan dan keselamatan penerbangan adalah suatu kondisi untuk mewujudkan penerbangan dilaksanakan secara aman dan selamat sesuai dengan rencana penerbangan.

Dari pernyataan kalimat diatas, kami dapat menyimpulkan bahwa untuk mewujudkan panerbangan yang baik, maka terlibih  dahulu penerbangan tersebut harus mempunyai komitmen yang berkesinambungan supaya penerbangan tersebut dapat dilaksanakan dengan keselamatan dan keamanan sesuai dengan standar keamanan dan keselamatan internasional. Misalnya, maskapai Emirates yang telah mempunyai keamanan  dan keselamatan yang memenuhi standar internasional penerbangan, disamping maskapai ini mempunyai pelayanan full services.

Baca lebih lanjut

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 2)


Kelompok      : 10

Ketua             : Rahmadya Karisma Haris (224110327)

Anggota         : Veronica (224110019)

Meyta Rezky Setiorini (224110101)

Sherly Septirani (224110224)

Kelas              : S1-ZU-10

Landasan Teori

Perusahaan pastinya menginginkan jika para pelangannya memiliki tingkat loyalitas yang tinggi terhadap perusahaan, hal tersebut dapat tercermin dengan cara pembelian berulang yang dilakukan para pelangan terhadap produk yang dihasilkan perusahaan, untuk itulah CRM diperlukan. Menurut Storbacka dan Lehtinen (2001:3) CRM merupakan hubungan yang kooperatif antara provider dengan pelanggan sehingga kedua pihak sama-sama untung melalui pembentukan hubungan yang dapat meningkatkan nilai mereka.

Perusahaan dalam mengembangkan kultur usahanya berorientasi costumer-centric yang ditujukan untuk merebut hati konsumen. Penerapan CRM pun mencakup kegiatanoperasional perusahaan seperti pemasaran, penjualan, dan pelayanan, juga untuk analisis eksploitasi data konsumen demi meningkatkan kinerja perusahaan seperti data finansial pelanggan, data pemasaran, dan data layanan lainnya.

Tiga tahapan CRM menurut Kalakota dan Robinson (2004:121) yang dapat dilakukan oleh perusahaan adalah sebagai berikut:

1)  Acquire: mendapatkan pelanggan baru dengan memberikan kemudahan pengaksesan informasi, inovasi baru, dan pelayanan yang menarik.

2)  Enhance: meningkatkan hubungan dengan pelanggan yang telah ada melalui pemberian pelayanan yang baik terhadap pelanggannya (Customer Service). Penerapan cross selling atau up selling pada tahap kedua dapat meningkatkan pendapatan perusahaan dan mengurangi biaya untuk memperoleh pelanggan (Reduce Cost).

3)  Retain: mempertahankan pelanggan merupakan usaha perusahaan untuk mendapatkan loyalitas pelanggan dengan mendengarkan pelanggan dan berusaha memenuhi keinginan pelanggan.

Seiring berkembangnya teknologi dan kemampuan masyarakat dalam berinteraksi di social media maka CRM tradisional pun berevolusi menjadi SCRM (Social Costumer Relationship Management). Social CRM merupakan pendekatan yang dilakukan oleh perusahaan dan didukung oleh teknologi untuk membantu perusahaan memecahkan masalah bisnisnya dalam menghadapi dan berinteraksi dengan pelanggan. Social CRM dapat dikatakan sebagai perubahan besar dalam pendekatan bisnis untuk memecahkan masalah pelanggan dengan melibatkan twitter, facebook, atau dengan platform social lainnya.

Social CRM adalah sebuah filosofi dan strategi bisnis yang didukungoleh platform teknologi, aturan bisnis, proses, dan karakteristik sosial, dirancang untuk melibatkan pelanggan dalam percakapan kolaboratif dalam rangka memberikan nilai yang saling menguntungkan dalam lingkungan bisnis yang terpercaya dan transparan -Greenberg (2010:34),

Maka dengan menggunakan konsep Social CRM, terdapat korelasi antara people (masyarakat umum), process (otomatisasi cara dan penerapan CRM), dan technology (perangkat lunak dan social media) yang dapat mempengaruhi loyalitas pelanggan.

 

Penyebab dari Keterlambatan suatu Penerbangan


Nama : Yusnita Desmawari Putri

NIM : 224110051

Kelas : S1 MTU A

 

Pendahuluan

Produk utama dari perusahaan atau airlines adalah untuk menyediakan jasa angkutan penumpang dan barang yang cepat, aman, dan nyaman. Kinerja dari airlines dapat dilihat dari 3 aspek utama yaitu keselamatan dan keamanan, ketepatan waktu, dan pelayanan. Dari ketiga aspek tersebut, secara umum airlines di indonesia belum menunjukan kualitas terbaiknya, sebagian besar masih dalam kategori kurang baik. Masih rendahnya kualitas keselamatan dan keamanan penerbangan di Indonesia, ditandai dengan tingginya angka kecelakaan penerbangan. Baca lebih lanjut

PILOT LALAI, PENUMPANG LUNGLAI


Kelompok 9

Tugas 2

1.Ketua :              – Diana Fatma Raininta (2241.10.308)

2.Anggota :         -Mia Rahmah (2241.10.329)

-Nita Nurjanah (2241.10.313)

-Novi Arista (2241.10.321)

KELAS : ZU-10

 

LANDASAN TEORI

Dalam dunia penerbangan hal yang diprioritaskan adalah keselamatan penerbangan yang mencakup  beberapa aspek sebagai penunjang keselamatan, salah satunya adalah pilot sebagai aspek sumber daya manusia yang bertanggung jawab penuh atas keselamatan seluruh awak pesawat dan penumpang. Oleh karena itu sangatlah penting bagi pilot untuk memiliki lisensi dan standardisasi yang sesuai dengan undang-undang yang berlaku, selain itu profesionalitas pun dibutuhkan agar menghasilkan penerbangan yang aman dan nyaman.

 Penting bagi seorang pilot untuk memperhatikan ketentuan-ketentuan yang berlaku sebagaimana yang telah ditetapkan oleh Dirjen Perhubungan dalam surat edaran dengan No AV/Jh6D I DKUPPU /t.:2..pe 1111/2011 yang mengharuskan setiap pilot hanya diperbolehkan menerbangkan pesawat tidak lebih dari 30 jam dalam seminggu, 110 jam dalam satu bulan kalender dan tidak lebih dari 1.050 jam dalam satu tahun kalender.  Hal ini merupakan ketentuan yang digunakan sebagai penunjang untuk keselamatan penerbangan, namun dalam kenyataannya masih ditemukan beberapa pilot yang telah melanggar jam terbang sebagaimana diatur pada peraturan yang berlaku. Bagi pilot yang melanggar, maka akan dikenakan sanksi berupa pembekuan sertifikat selama 1 sampai 6 bulan dan/atau pencabutan sertifikat. Sanksi kedua diajukan ke pengadilan dengan sanksi pidana penjara paling lama 2 tahun dan denda paling banyak Rp 500.000.000,00.

Pada contoh kasus lainnya, salah satu maskapai penerbangan yang pilotnya pernah terlibat kasus narkotika dan sempat mengancam keselamatan penumpang dalam penerbangan membuat pencitraan terhadap pilot menurun. Hal tersebut membuat masyarakat berfikir bahwa bepergian menggunakan pesawat terbang menjadi tidak aman. Bagi pilot yang menggunakan narkotika akan dijerat undang-undang No 35 Tahun 2009 tentang narkotika dan obat-obatan terlarang, selain itu sanksi lainnya adalah pencabutan lisensi dan sertifikasi kerja. Dengan begitu diharapkan pilot Indonesia dapat lebih introspeksi diri dalam menjalankan tugas dan kewajibannya.

APAKAH FSC (FULL SERVICE CARRIER) KURANG DIMINATI DENGAN HADIRNYA LCC (LOW COST CARRIER)? LANDASAN TEORI (PART II)


Kelompok : 1 (Tugas 2)

Ketua :

Netti Yuliarti (2241.10.176)

Anggota :

Elparida Arni B (2241.10.133)

Claudia Kartika C (2241.10.163)

Kelas : S1 ZU10

 

LANDASAN TEORI

Kebutuhan masyarakat akan transportasi udara yang semakin meningkat mengakibatkan bukan hanya masyarakat kelas atas Baca lebih lanjut

Maskapai Indonesia Dianggap Aman oleh Dunia (Part 01) (Rev 01)


Kelompok  : 1

Nama: Taufans rizkyanto                   : 224110121

Christophorus linggatantra  : 224110171

Albert parlindungan               : 224110126

Bahrul ulum                            : 224110293

Kelas : MTU-A

Tugas : 1

  1. Latar Belakang.

Bisnis airlines bukan merupakan hal yang baru didunia penerbangan. Berdasarkan PERATURAN PEMERINTAH TENTANG KEAMANAN DAN KESELAMATAN PENERBANGAN, Bab I KETENTUAN UMUM, Pasal 1 ayat 1 yaitu: Keamanan dan keselamatan penerbangan adalah suatu kondisi untuk mewujudkan penerbangan dilaksanakan secara aman dan selamat sesuai dengan rencana penerbangan.

Namun apa jadinya jika suatu bisnis ini dinodai dengan buruknya tingkat keselamatan dan keamanan sebuah maskapai penerbangan.apalagi maskapai ini milik Negara. Beberapa bulan lalu ada sebuah stasiun televisi,  menyebutkan bahwa Indonesia, Angola, Liberia, Sudan, dan Korea Utara adalah lima negara dengan maskapai penerbangan paling tidak aman didunia, menyusul serangkaian insiden dan kecelakaan yang terjadi terhadap beberapa maskapai penerbangan dunia dalam beberapa bulan terakhir ini. Dalam acara ini salah seorang Redaktur Senior Jurnal Manajemen Penerbangan mengungkapkan bahwa tingkat keselamatan berbagai maskapai penerbangan Indonesia, termasuk Garuda Indonesia, masih dipandang buruk. Bahkan, sempat mempertanyakan alasan kenapa Pemerintah Australia yang tidak mengikuti langkah Uni Eropa yang sudah terlebih dahulu melarang maskapai penerbangan dari 18 negara, termasuk Indonesia.

Sejauh ini, Garuda Indonesia merupakan satu-satunya maskapai penerbangan Indonesia yang terbang ke Australia untuk melayani rute penerbangan Denpasar-Sydney, Denpasar-Perth, dan Denpasar-Melbourne.

Baca lebih lanjut

Tanggapan Masyarakat Tentang Low Cost Carriers (LCCs), Landasan Teori


Nama Kelompok  :   Ketua : Dimas Satrio Putra Gunawan  (224108210)

                                        Anggota  :  1. Mentari Noor (224110251)

                                                               2. Barkatullah (224110231)

Kelas : S1 MTU-A

Tugas : 2

LANDASAN TEORI

             Sekarang kami akan memberikan landasan teori berdasarkan survey yang sudah kami buat. Dalam hal ini kami akan menggunakan teori biaya, teori kualitas layanan dan teori pemasaran jasa penerbangan. Kami memilih teori ini, karena menurut kami teori ini sangat berhubungan dengan judul dari tugas yang kami buat yaitu mengenai Low Cost Carriers (LCCs). Baca lebih lanjut

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 1)


Kelompok      : 10

Ketua             : Rahmadya Karisma Haris (224110327)

Anggota         : Veronica (224110019)

Meyta Rezky Setiorini (224110101)

Sherly Septirani (224110224)

Kelas              : S1-ZU-10

 Pendahuluan

Teknologi informasi berkembang dengan sangat cepat dan telah menjadi bagian dalam kehidupan sehari-hari. Hampir seluruh informasi dengan mudahnya dapat diakses oleh masyarakat pada umumnya. Bukan hanya dari kalangan masyarakat umum tetapi perusahaan pun telah menggunakan teknologi informasi untuk melakukan pedekatan dengan para customer, karena tidak dapat dipungkiri bahwa teknologi informasi menciptakan ruang baru yang memberikan kesempatan bagi penggunanya untuk Baca lebih lanjut

APAKAH FSC (FULL SERVICE CARRIER) KURANG DIMINATI DENGAN HADIRNYA LCC (LOW COST CARRIER)? (PART I) (REV.02)


Kelompok : 1 (Tugas 1)

Ketua :

Netti Yuliarti (2241.10.176)

Anggota :

Elparida Arni B (2241.10.133)

Claudia Kartika C (2241.10.163)

Kelas : S1 ZU10

PENDAHULUAN

Sekarang ini LCC memang sedang booming di kalangan pengguna transportasi udara. Disamping harga tiket yang murah namun tetap mengutamakan aspek keselamatan merupakan pertimbangan mengapa LCC sangat diminati oleh masyarakat. Meskipun dalam LCC hanya disajikan pelayanan yang minimalis, hal ini tidak menjadi kendala bagi masyarakat untuk menggunakan layanan LCC.

Namun bukan berarti dengan adanya fenomena LCC, kemudian FSC (Full Service Carrier) menjadi tidak Baca lebih lanjut

BISNIS AIRLINE, JUDI atau GENGSI ? (PART I) (REV 01)


Kelompok : 1

Ketua :

Netti Yuliarti (2241.10.176)

Anggota :

Elparida Arni B (2241.10.133)

Claudia Kartika C (2241.10.163)

Kelas : S1 ZU10

 

PENDAHULUAN

Banyak hal menarik yang dapat kita peroleh dari dunia penerbangan, salah satunya adalah bisnis airline yang semakin menggiurkan. Bisnis airline selalu saja mengundang rasa ingin tahu dan membuatnya bagaikan rasa manis yang menggoda untuk dicicipi banyak orang. Apalagi bisnis ini dikenal sebagai bisnis yang flamboyan. Namun apakah benar bisnis airline mampu mendatangkan keuntungan yang melimpah bagi sang empunya bisnis? Coba kita cari tahu.

Ada sebuah anekdot yang sering terdengar mengenai bisnis airline yang berbunyi : “How to make a millionaire? Just find a billionaire and get him/her to take an airline!”. Dari anekdot ini sama sekali tidak tercermin bahwa bisnis airline adalah bisnis yang paling mendatangkan keuntungan. Sebaliknya dalam top 10 bisnis berskala besar dunia, bisnis airline hanya menempati peringkat ke 7, sedangkan peringkat pertama justru ditempati oleh bisnis pertambangan (minyak bumi). Mengapa demikian? Antara lain karena membutuhkan capital yang sangat besar, sementara keuntungan yang bisa diraih dari bisnis aviation ini sangat kecil. Jadi sebaiknya jika ingin mendirikan sebuah airline, harus dikelola oleh orang yang betul-betul menguasai bidang aviasi, sehingga “memungkinkan” untuk dapat memperoleh benefit atau revenue yang layak.

Nah, itu sebabnya, biasanya, bisnis airline selalu dimulai oleh pemerintahnya terlebih dahulu. Hal ini berlaku diseluruh dunia. Karena dapat dengan mudah memperoleh capital yang besar dari penginvestasian subsidi. Selain itu juga sebagai symbol Negara di mata dunia, atau dikenal dengan The Flag Carrier, yang dapat membawa Indonesia ke dunia internasional melalui penerbangan.

Lalu mengapa bisnis airline tetap saja merangsang untuk digeluti? Ada dua hal yang menyebabkan bisnis airline terasa sangat atraktif, yang pertama adalah “gengsi”. Seperti dikatakan sebelumnya, bisnis ini dikenal sebagai bisnis yang flamboyan yang diyakini hanya merupakan bisnis kalangan atas. Wah ini jelas, wong modalnya saja triliunan kok. Maka dari itu banyak anggapan bisnis airline dapat meningkatkan derajat si pemiliknya. Yang kedua adalah “cash flow yang tinggi”. Padahal sudah banyak diketahui bahwa dalam bisnis ini, yang terjadi yield-nya sangat rendah. Justru kemungkinan untuk meruginya yang terbilang besar. Bayangkan berapa cost yang harus dikeluarkan untuk setiap penerbangan, hanya untuk biaya bahan bakar saja diperlukan berjuta-juta rupiah untuk memenuhi kebutuhan beribu-ribu liter avtur. Belum lagi kendala-kendala lain yang dapat menghambat pemasukan cash, seperti risiko bencana alam, regulasi pemerintah, kondisi ekonomi dan sosial dan lainnya. Dalam hal ini diberikan dua jempol bagi pemerintah Indonesia, yang sudah memberlakukan persyaratan yang lebih “ketat” bagi investor yang ingin membuka bisnis airline.

Namun lagi-lagi masih saja banyak orang yang berbondong-bondong untuk membuka bisnis airline. Yang disayangkan, kebanyakan dari mereka yang mendirikan airline, kurang mengetahui seluk beluk dunia aviasi. Banyak juga dari mereka yang hanya mementingkan besarnya tingkat profit yang dapat diperoleh, sehingga faktor safety menjadi sedikit terabaikan. Maka pendirian bisnis ini hanya menjadi aktivitas judi.

Itulah yang terjadi, sehingga banyak saja airline yang runtuh akibat kurangnya pengetahuan maupun modal. Tetapi apapun masalahnya, bisnis airline tetap menjadi bisnis berskala besar yang di satu pihak mampu menarik pemiliknya hingga ke atas langit ke-7, namun di pihak lain justru dapat mendorong pemiliknya hingga terjerembab ke jurang tak berdasar. Sungguh ironis.

Sumber : http://top10.web.id/bisnis/10-bisnis-skala-besar-dunia

MEDIA SOSIAL SEBAGAI ALAT INTERAKSI AIRLINES (part 1)


Kelompok      : 10

Ketua             : Rahmadya Karisma Haris (224110327)

Anggota         : Veronica (224110019)

Meyta Rezky Setiorini (224110101)

Sherly Septirani (224110224)

Kelas              : S1-ZU-10

Pendahuluan

Teknologi informasi berkembang dengan sangat cepat dan telah menjadi bagian dalam kehidupan sehari-hari. Hampir seluruh informasi dengan mudahnya dapat diakses oleh masyarakat pada umumnya. Bukan hanya dari kalangan masyarakat umum tetapi perusahaan pun telah menggunakan teknologi informasi untuk melakukan pedekatan dengan para customer, karena tidak dapat dipungkiri bahwa teknologi informasi menciptakan ruang baru yang memberikan kesempatan bagi penggunanya untuk Baca lebih lanjut

Pilot Lokal vs Pilot Impor


Kelompok   : 3

Ketua         : Apsada Juhri (224110131)

Anggota  : Rio Hafiz Al Caesar (224110079)

Indria Ulufi (224110199)

Feli Ervina (224110180)

Kelas : ZU 10

Di dalam dunia penerbangan, pilot adalah unsur yang dianggap paling penting. Pilot adalah sebuah ujung tombak dalam suatu penerbangan. Seorang komandan yang membawa pesawat udara, terbang dari suatu tempat ke tempat lain. Tanggung jawab pilot terbilang sangat besar. Dalam satu penerbangan, pilot rata-rata bertanggung jawab atas nyawa ratusan penumpang.

Tanggung jawab yang besar sudah sepatutnya diimbangi oleh pelayanan kepada pilot yang seimbang dari maskapai penerbangan. Masih terbayang dalam pikiran kita mengenai rencana pemogokan yang akan coba dilaksanakan oleh Asosiasi Pilot salah satu maskapai ternama di Indonesia tahun 2011 lalu. Ancaman pemogokan pilot ini bisa menjadi masalah serius bagi dunia penerbangan. Bayangkan saja apabila Baca lebih lanjut

Tanggapan Masyarakat Tentang Low Cost Carrier (LCC)


Nama Kelompok  :  1. Ketua : Dimas Satrio Putra Gunawan  (224108210)

                                       2. Anggota  : Mentari Noor (224110251)

Kelas : S1 MTU-A

Tugas : 1

 

LATAR BELAKANG

Manfaat dari transportasi udara adalah sarana untuk mencapai  tujuan dengan lebih cepat dan dapat mengangkut barang-barang yang sifatnya cepat rusak seperti  makanan karena jarak waktu yang ditempuh lebih singkat dibandingkan transportasi lainnya dan transportasi udara sangat berdampak bagi pertumbuhan ekonomi investasi internasional karena dapat mencapai negara-negara internasional. Namun dengan seiringnya waktu populasi penduduk sangat meningkat dan ini menjadikan persaingan bagi perusahaan-perusahaan penerbangan airlines dengan cara membuat strategi untuk menarik minat masyarakat. Sehingga menyebabkan adanya konsep “low cost carriers” (LCCs). Baca lebih lanjut

CIRI KHAS MASKAPAI GARUDA


Nama: Hayu Murlani

NIM: 224109120

Tugas GH 3

CIRI KHAS MASKAPAI GARUDA

Baru baru ini garuda indonesia mengeluarkan layanan khas atau berbeda dari maskapai lain untuk melayani penumpang sesuai kultur budaya tradisional khas Garuda Indonesia. Layanan khas yg di berikan oleh maskapai garuda berupa: lagu-lagu daerah Indonesia  dan wewangian tradisional dari bahan rempah-rempah khas Indonesia.

Maskapai garuda Indonesia mempunyai ide atau gagasan tentang menciri khas kan budaya indonesia tersebut dengan tujuan untuk lebih mengetahui kebudayaan Indonesia dan untuk melestarikan budaya Indonesia agar tidak diakui oleh negara lain serta pelayanan yang diberikan oleh maskapai Garuda berbeda dari maskapai lain dan memberikan  kenangan khusus pada penumpang.

Kelompok 4 : Penambahan In-Flight Entertainment? KenapaTidak?!


Dea Rivai Putra ( 2241 09 324 )

Ummi Ade Rocheni ( 2241 09 265 )

Irelda Verazty ( 2241 09 031 )

Annisa Nindya Kusuma ( 2241 09 343 )

 

Kesimpulan

Tugas GH kali ini masih berkaitan dengan minggu minggu sebelumnya, yaitu pembahasan mengenai judul yang sudah kami tetapkan, “Penambahan In-Flight Entertainment? KenapaTidak?!”. Tulisan yang kami susun selama lebih dari 2 bulan ini sekarang sudah mencapai tahap terakhir. Baca lebih lanjut

Pelayanan terhadap penumpang domestik bandara soekarno hatta


Diky leo zayanurizal     ( 224109041)

Esti ariami s                ( 224109081)

Niken larasati              ( 224109113)

Aflia sari                      (224109192)

Untuk tugas di minggu ke 7 ini kami kerjakan bersama-sama.

 

Hasil analisis

Melanjuti analisis kami di minggu ke 6 dengan metode kualiatif (desriptif) yang kami pilih Secara umum,berdasarkan jawaban respnden ,dapat disimpulkan bahwa secara keseluruhan harapan responden terhadap ke-15 butir aspek pelayanan yang kami diteliti  relative tinggi. Baca lebih lanjut

Batal Take Off di Sentani, Pilot Garuda Rasakan Pesawat Tak Imbang


Batal Take Off di Sentani, Pilot Garuda Rasakan Pesawat Tak Imbang

Nama                    : Fransiscus Sigit Wicaksono

Nim                       : 224109075

Kelas                    : C

Tugas GH ke 5

 

Seperti yang diberitakan oleh detik.com beberapa waktu lalu bahwa pesawat Garuda Indonesia jenis boeing 737-800 dengan nomor penerbangan GA 653 rute jayapura – timika batal take off di bandara sentani jayapura, hal ini disebabkan karena ketidakseimbangan pesawat.  Pada saat awal melakukan rolling pilot sudah merasakan bahwa ada tendensi dari pesawat yang lebih condong ke kanan, pilot itu sendiripun sudah mencoba menstabilkan pesawat dengan rudder ( penstabil di ekor pesawat ) dan setir pesawat.  Namun pilot masih merasakan ketidakseimbangan pada pesawat.

Akhirnya untuk keselamatan para penumpang pilot tersebut memutuskan untuk membatalkan penerbangan dan seluruh penumpang yang berjumlah 153 orang dan 7 awak pesawatpun keluar dari pesawat dengan keadaan baik.

Menurut saya keputusan yang diambil oleh pilot pesawat ini sangat tepat dan patut ditiru oleh pilot – pilot lain dimana sekarang ini sedang maraknya pilot “koboi” yaitu pilot standby yang bersedia / memaksakan terbang walaupun Ia tahu bahwa pesawat dalam keadaan tidak layak terbang yang dapat berakibat fatal bagi penerbangan itu sendiri. Dalam hal ini para petugas load control juga harus lebih teliti dalam melakukan perhitungan agar pesawat dapat seimbang dan tidak membahayakan penerbangan seperti pada kasus pesawat garuda yang gagal take off di jayapura.

FASILITAS MENDUKUNG PRODUKTIFITAS PADA PERUSAHAAN AIRLINES


NAMA             : MELVA SUCI .A.

NIM                 : 224109178

KELAS           : C

TUGAS          : 4 GH2

 

FASILITAS MENDUKUNG PRODUKTIFITAS PADA PERUSAHAAN AIRLINES

Fasilitas yang ada pada perusahaan airlines tidak sesuai dengan kenyataannya. Karena masih banyak passengger mengeluh dengan keadaan fasilitas yang tel;ah di berikan. Contohnya saja banyak terjadi delay, complain penumpang. Hal yang paling membuat penumpang bosan yaitu pada saat delay, sehingga para penumpang harus menunggu lama. Fasilitas keamanannya pun kurang di perhatikan oleh perusahaan airlines. Karena fasilitas keamanan sangat fital sekali bagi penerbangan.

Fasilitas yang kurang memadai sangat mempengruhi produktifitas pada perusahaan arlines. Karena kebanyakan para masyarakat ingin mendapatkan fasilitas yang aman dan nyaman sesuai dengan apa yang sudah di sediakan oleh perusahaan airlines. Fasilitas yang bagus dapat menjadikan perusahaan ailines semakin maju dan diminati banyak orang.

FREKUENSI KE EROPA BERKURANG, ASIA PASIFIK MENINGKAT


FREKUENSI KE EROPA BERKURANG, ASIA PASIFIK MENINGKAT

Nama              : Johansyah Putra

NIM                 : 2241-09-008

Kelas              : C

Tugas Ground Handling ke – 5

Harga minyak dunia sekarang-sekarang ini meningkat, bertambah sekian puluh US Dollar per barrelnya. Seperti yang kita ketahui bahwa dunia penerbangan ialah dunia yang penuh resiko, padat modal, berteknologi tinggi dan zero error. Belum lagi yang sedang terjadi di benua Eropa sekarang ini, yaitu resesi ekonomi dan naiknya harga minyak dunia. Baca lebih lanjut

Tahukah Anda Terjadinya Penembakan Terhadap Trigana Air ?


Tahukah Anda Terjadinya Penembakan Terhadap Trigana Air ?

 

Nama             : Muhammad Dwi Iskandar Zulkarnain

Nim                 : 224109322

Kelas              : S1 MTU C Ground Handling

Tugas GH ke 5

Dalam kesempatan kali ini saya akan membahas tentang terjadinya penembakan yang terjadi di Bumi Papua terhadap pesawat Trigana Air yang sedang mendarat di Bandara Mulia, Puncak Jaya.

Berdasarkan dari artikel yang saya baca di jpnn.com penembakan terjadi ketika pesawat hendak melakukan parkir di apron bandara dan tiba – tiba muncul sekelompok orang yang berjumlah lebih dari 5 orang menembaki pesawat. Tembakan – tembakan tersebut menembus pesawat lalu mengenai para penumpang pesawat. Lalu apa yang menyebabkan sekelompok orang – orang tersebut melakukan penembakan ? Baca lebih lanjut

SAS Merombak Seat Pesawat


SAS Merombak Seat Pesawat

Nama: Selyka Janita

Nim: 224109210

Kelas: S1 MTU C (09)

Tugas GH2 yang ke 5

SCANDINAVIAN Airlines (SAS) berencana mengganti 3.520 kursi diarmada narrowbody dengan seat yang baru, lebih ringan, dan ramping untuk kelas ekonomi pada bulan Mei mendatang. Pada saat yang sama, pesawat akan dilengkapi dengan wi-fi. Menurut SAS, 70% dari bisnisnya adalah rute jarak pendek dan 30% sisanya adalah pada rute jarak jauh. Seiring dengan pengubahan kursi di pesawat, SAS akan meluncur 25 rute baru tahun ini. Baca lebih lanjut

Wow .. Aplikasi-aplikasi Penerbangan serbu Android!


Wow .. Aplikasi-aplikasi Penerbangan serbu Android!

Nama           : Fransiscus Sigit Wicaksono

Nim              : 224109075

Kelas            : C

Tugas GH ke 4

 

Saya sempat membaca artikel tentang aplikasi pada gadget  yang berbasis Android beberapa waktu lalu, dalam artikel tersebut dipaparkan bahwa kini aplikasi tentang penerbangan dapat di download langsung pada android anda, aplikasi yang ditawarkan antara lain Indonesia FlightBoard Android Apps dan aplikasi Tiket Pesawat. Aplikasi flightboard ini berguna untuk membantu anda menemukan informasi penerbangan langsung pada beberapa bandara di Indonesia, untuk flightboard ini terdapat 25 bandara yang tersedia dalam database. Flight data dan informasi yang disajikan dalam aplikasi ini berupa streaming dari situs resmi bandara masing-masing yang disajikan secara realtime.

Sedangkan untuk aplikasi Tiket Pesawat pada android dapat memungkinkan kita untuk mengecek tarif tiket dan informasi jadwal penerbangan terkini  ke berbagai kota di Indonesia untuk maskapai penerbangan Garuda Indonesia, Lion Air, Batavia Air, Citilink, dan Sriwijaya Air. Kedua aplikasi yg sangat bermanfaat ini dapat kita download gratis via google play, sangat menarik bukan J

Selain itu beberapa waktu lalu Aircell memperkenalkan smartphone penerbangan pertama di dunia, dimana smartphone tersebut dapat memungkinkan kita untuk melakukan atau menerima panggilan telefon selama penerbangan terjadi dengan kualitas jaringan yang tetap jernih, tentu ini akan sangat berguna bagi orang-orang bisnis yang perlu tetap berhubungan dengan klien bahkan selama penerbangan sekalipun.

Progres Delay


Kelompok 5

Ketua       :  Yurike Nalurita (243111024)

Anggota  :  Irmalia F (243111018)

Erick Firdianto S (243111013)

Aditya Marga S (243111012)

 

Ada kesalahan dari sistem di link yang sebelumnya sehingga kami membangun sistem kembali di link yang baru yang mengakibatkan kuisioner yang telah diisi oleh beberapa orang harus diisi kembali dan disebarkan lagi. Progres kami kedepan, kami akan menyurvei atau menganalisa kembali apa yang terjadi di lapangan sehingga apa yang kami tulis dapat dipertimbangkan dan juga dapat dipertanggungjawabkan.

Pembelian Pesawat Jet Bombardier


NAMA   : DANIEL ARDIKA OKTAVIANUS

NIM       :  2241 09 306

TUGAS  : GROUND HANDLING KE-4

KELAS   : S1 MTU C

 

 

Singapura – Menteri BUMN Dahlan Iskan menghadiri penandatanganan pembelian 18 pesawat jet Bombardier oleh PT Garuda Indonesia Tbk di Singapura. Dahlan senang dengan aksi Garuda tersebut.

“Pertama kali dalam sejarah ini. Dimana Garuda itu sebagai perusahaan penerbangan nasional beli pesawat tapi nggak ngerepotin negara,” tutur Dahlan usai penandatanganan yang dilakukan di acara Singapore Airshow, Singapura, Rabu (15/2/2012).

Dijelaskan Dahlan, maksudnya tidak merepotkan negara adalah karena pembelian pesawat yang dilakukan oleh Garuda tidak menggunakan dana APBN dan tidak memerlukan penjaminan dari pemerintah.

“Jadi tidak ada sesuatu yang merepotkan pemerintah. Sepenuhnya B to B (business to business),” ujar Dahlan.
Opini:

Perkembangan yang sangat baik bagi Garuda, mereka mulai berhenti bergantung kepada pemerintah dan mandiri dalam menjalankan bisnis mereka, meskipun Garuda adalah perusahaan penerbangan nasional tapi sudah sepantasnya mereka mulai mendiri dan menggurangi penggunaan APBN untuk membiayai proses produksi mereka. Saya pikir saat ini Garuda sudah bisa mendapatkan laba, dan ini adalah saat yang tepat bagi Garuda untuk menjadi perusahaan yang mandiri dan tidak selalu merepotkan Pemerintah.

Kenakalan Petugas Kargo Mencuri Paket di Bandara Sepinggan


Amalia Kusumadewi

224109122

Tugas IV Ground Handling Kelas C

 

Kenakalan Petugas Kargo Mencuri Paket di Bandara Sepinggan

Seorang penumpang pesawat merekam aksi petugas kargo yang mencuri paket di Bandara Internasional Sepinggan, Balikpapan, Kalimantan Timur. Rekaman itu berdurasi 1,5 menit. Dalam rekaman, seorang petugas kargo membuka paket kiriman dengan menggunakan sebuah pena. Ia memindahkan isi paket berupa kepiting ke dalam kantong plastik. Kasus pencurian dan kehilangan barang berharga kerap terjadi di Bandara Sepinggan. Sebuah perusahaan ekspedisi mengaku pernah kehilangan barang yang dikirim dari Surabaya, Jawa Timur, melalui bandara tersebut. PT Aviako Sepinggan akan menindak tegas pelaku pencurian. Perusahaan jasa kargo itu akan memperketat pengawasan agar kejadian serupa tak terulang lagi.

Bagaimana bisa petugas yang seharusnya dipercaya bertugas untuk mengantar paket pelanggan dengan aman sampai tujuan malah menyalahgunakan tugasnya demi keuntungan pribadi. Bukankah setiap petugas kargo harus mempunyai izin khusus untuk masuk ke lingkungan bagian dalam bandara. dan setahu saya hanya perusahaan kargo tertentu yang sudah memiliki ikatan kerja sama dengan airlines yang di izinkan masuk. Dari sekian banyak petugas bandara mengapa tidak ada yang mengawasi in dan outnya barang cargo. Seharusnya pengawasan dan keamanan di bandara terutama di bagian penangan kargo dan bagasi tidak sembarang orang dapt masuk, melainkan hanya orang yang memiliki license, dan diharapkan bagi perusahaan kargo maupun bandara melakukan pelatihan khusus, tes dan inspeksi secara berkala agar dapat menciptakan SDM yang berkualitas.

Demo Mahasiswa Menyebabkan Pesawat Wings Air Gagal Mendarat


Amalia Kusumadewi

224109122

Tugas III Ground Handling Kelas C

 

Demo Mahasiswa Menyebabkan Pesawat Wings Air Gagal Mendarat

Pendudukan Bandara Sultan Babullah Ternate, Maluku Utara, oleh mahasiswa membuat pesawat Wings Air rute Manado, Sulawesi Utara-Ternate, Maluku Utara, tidak jadi mendarat. Pesawat terpaksa kembali ke Manado. Pasalnya saat akan mendarat pesawat dilempari batu, Rabu (28/3/2012). Kabid Humas Polda Maluku Utara AKBP Ramli menjelaskan, pesawat yang sarat penumpang tersebut memilih balik ke Manado karena landasan pacu dikuasi oleh mahasiswa.

Menurut saya demo di bandara merupakan tindakan yang sangat bodoh. Apalagi sampai menyebabkan pesawat gagal mendarat. Hal itu dapat menyebabkan kerugian yang sangat besar bagi airlines itu sendiri, bandara dan juga negara. Kegiatan bandara memerlukan biaya yang besar dan merupakan salah satu perusahaan yang dapat mempengaruhi perekonomian negara. Apabila bandara lumpuh total walaupun hanya dalam waktu dua jam itu sudah merupakan kerugian yang sangat besar bagi perusahaan penerbangan maupun negara.

Lagipula tidak ada hubungannya demo BBM dengan kegiatan bandara karena pesawat menggunakan bahan bakar aftur. Para pendemo tidak hanya menyebabkan pesawat gagal mendarat, tetapi juga merusak fasilitas umum baik didalam maupun diluar lingkungan bandara dan mobil milik Satuan Lantas Polresta Ternate, mobil dinas TNI AL, dan mobil berpelat hitam menambah daftar kerugian bandara dan negara.

Alangkah baiknya para pendemo memikirkan terlebih dahulu matang-matang dampak buruk sebelum melakukan tindakan anarkis, tidak hanya mengikuti emosi sesaat. Fasilitas-fasilitas tersebut dibuat dari uang rakyat apabila dirusak rakyat juga yang semakin sengsara.

Kata Nearmis Dalam Masalah Penerbangan, Maksudnya apa ya?


Kata Nearmis Dalam Masalah Penerbangan, Maksudnya apa ya?

NAMA        : WISNU HANDOYO

NIM            : 224107257

KELAS       : C

TUGAS KE : 1

 

Nearmiss kebanyakan diterjemahkan sebagai near to collision, hampir bertabrakan. Pramugari dan pramugara ada kewajiban selama terbang terutama penerbangan yang lebih dari satu jam untuk mengecek cockpit dan toilet (lavatory).
maksudnya untuk memastikan bahwa tidak terjadi sesuatu di dalam kokpit dan atau toilet.

 

Biasanya setiap 15 menit pramugari mengetuk dan melihat kokpit untuk memastikan bahwa pilot masih hidup dan sehat walafiat. Kalau ke toilet saya kurang tahu setiap berapa menit, mungkin 15 menit sekali juga, sama dengan kokpit. Kalo kurang dari 15 menit pramugari keluar masuk toilet, mungkin dia lagi ada masalah dengan saluran pencernaannya. Semua kegiatan dia atas sebenarnya adalah alasan safety dan ada aturannya di setiap airline.

Manusia Virtual Gantikan Pegawai Bandara


Manusia Virtual Gantikan Pegawai Bandara

NAMA  : WISNU HANDOYO

NIM      : 224107257

KELAS : C

Tugas Ke: 4

 

Agen penerbangan ‘virtual’ mulai menyapa para penumpang di bandara Prancis. Hal ini guna menggantikan tenaga kerja manusia yang tak bisa selalu tersenyum.
Pegawai ‘virtual’ ini dipertaruhkan untuk menggantikan manusia yang tak selalu bisa tersenyum dan butuh istirahat. Proyek awal berlangsung di bandara Orly Prancis mulai bulan lalu. Sejauh ini, proyek ini berhasil menghibur para pelancong dan membuat mereka terkejut.

 

Begitu meyakinkannya, seringkali ada orang yang mencoba menyentuh dan berbicara dengan gambar video yang menyapa mereka dan mengarahkan mereka ke gerbang penerbangan. Gambar yang muncul muncul begitu saja ketika agen penerbangan (manusia nyata) menekan tombol untuk memberi sinyal penerbangan akan dimulai. Pegawai ‘virtual’ ini sebenarnya diproyeksikan ke siluet dengan bentuk manusia yang terbuat dari plexiglass.

 

Sebanyak tiga agen bandara nyata difilmkan di studio untuk menciptakan ilusi yang diharapkan akan lebih menarik dan mudah bagi penumpang memahami mereka dibanding layar terminal elektronik tradisional. “Selamat pagi! Silahkan pergi ke gerbang boarding. Bandara Paris mengucapkan selamat bepergian,” kata gambar yang muncul sementara nama tujuan berkedip di depannya. Otorita bandara AdP menjadi pelopor ide ‘hologram 2-D’ ini di awal tahun.

 

Hal ini menjadi cara yang cukup menguras pikiran saat akan memodernisasi Hall 40, salah satu dari lusinan gerbang boarding di bandara kedua Paris, di selatan ibukota. Direktur operasional bandara Didier Leroy mengatakan, “Anak-anak menyukainya. Mereka tertarik dan mencoba bermain dengannya,” katanya.  Namun, ada pula sedikit pihak yang menganggapnya tak berguna atau hanya sebuah alat, lanutnya. Teknologi di balik gambar ini dikembangkan agensi pemasaran audiovisual Paris, L’Oeil du Chat.

 

Agen maya serupa juga bisa ditemui di bandara London dan Manchester sejak awal tahun ini. Hall 40 melayani 30-40 penerbangan tiap harinya, ujar Leroy. Sekitar satu juta penumpang per tahun melewatinya, terutama pada perjalanan ke selatan Prancis dan Corsica. Pihak bandara memutuskan membuat ‘laboratorium’ pengujian cara baru guna mengorganisir gerbang boardingnya. Gerbang boarding di bandara ini mengalami perombakan besar-besaran musim semi ini untuk menciptakan 40% ruang yang lebih besar dan 20% kursi yang lebih banyak sehingga dapat menampung 400 penumpang.

 

Saat penumpang naik pesawat ke Bastia di Corsica, anak lima tahun mendekati hologram dan mengucapkan, “Halo!”. Gambar pra-rekaman itu pun tersenyum, berkedip, melipat tangannya, melirik ke kiri namun tak mengatakan apa-apa. Leroy mengatakan, percobaan bandara dengan realitas virtual ini akan dievaluasi pada akhir tahun. Setelahnya, bisa diperluas untuk ruang boarding lain di Orly atau yang lebih besar, yakni di Charles de Gaulle Paris.

 

Beda Penyelamatan Merpati dan Garuda


Beda Penyelamatan Merpati dan Garuda

NAMA  : RACHEL FRANSISCA

NIM      : 224108264

KELAS : C

TUGAS KE: 4

 

Menteri Badan Usaha Milik Negara (BUMN) Mustafa Abubakar menyatakan penyelamatan PT Merpati Nusantara Airlines berbeda dengan PT Garuda Indonesia Tbk. Sebab, kondisi Merpati terus merugi sejak lama.

 

Kondisi Merpati sudah lama berdarah, maka diperlukan upaya khusus untuk menyehatkan maskapai itu, ujar Mustafa di Jakarta.

 

Penyelamatan Merpati itu melibatkan PT Perusahaan Pengelola Aset (PPA) yang juga mengusulkan berapa kebutuhan dana Merpati. Merpati tidak bisa diselamatkan dengan cara pelepasan saham seperti proses penawaran umum perdana (initial public offering/IPO) yang dilakukan Garuda.

 

Kalau Garuda IPO, Merpati mudah-mudahan dengan cara penyertaan modal negara (PMN), atau mungkin ada cara lain yang kami dalami. Menteri Keuangan Agus Martowardojo mengatakan, penyelamatan Merpati dilakukan dengan mengombinasikan restrukturisasi. Caranya, restrukturisasi mengombinasikan penyertaan modal negara dan subsidiary loan agreement (SLA).

 

Ia mencontohkan SLA seperti pinjaman dari China, sedangkan PMN merupakan suntikan dana pemerintah. Saya menunggu PPA bersama Menteri BUMN untuk menyampaikan proposalnya, kemudian kami bahas, tuturnya.

 

Sementara itu, terkait dugaan penggelembungan dana dalam pembelian pesawat Merpati, Mustafa mempersilakan pihak lain untuk memeriksa dan meneliti. Yang penting konsentrasi restrukturisasi Merpati tetap berjalan. Kami mempersilakan jika ada institusi lain memeriksa dugaan mark up.

 

GARUDA dan LOW COST CARRIER


GARUDA dan LOW COST CARRIER

Nama : Herna Silitonga

Nim: 224109220

Kelas GH: S1 MTU C(09)

Tugas GH II yang ke – 4

 

Low cost carrier (LCC) atau discounted carrier yang biasanya diartikan sebagai maskapai penerbangan bertarif rendah ini memang sedang maraknya disajikan oleh airlines dewasa ini. Cirinya yaitu, harga tiket pesawat yang murah dengan pelayanan yang minimalis namun tetap memperhtungkan aspek keselamatan. Lion Air, Batavia Air, Wings Air dan Sriwijaya Air adalah beberapa dari airline di Indonesia yang menggunakan konsep LCC. Baca lebih lanjut

KELAMNYA DUNIA PENERBANGAN INDONESIA


NAMA            : REFANI ENJELIA

NIM                : 224109295

TUGAS GH 4

KELAMNYA DUNIA PENERBANGAN INDONESIA

Tertangkapnya Pilot dari maskapai Lion Air ketika menkonsumsi narkoba jenis sabu-sabu, kembali membuat berbagai pihak bertanya-tanya apakah kehidupan pelaku dunia penerbangan sampai sekelam itu.

Menurut saya, sekarang ini memang sudah seperti trend yang membuka sisi gelap kehidupan awak penerbangan, khususnya pilot dan pramugari.Saya melihat ini seperti trend artis yang terlibat kasus narkoba.
Terjadinya berbagai kasus awak penerbangan yang menggunakan narkoba, lebih disebabkan karena pengawasan yang ada masih sangat longgar.Di Indonesia, semua peraturan pengawasan memang ada, tetapi dalam praktek pelaksanaannya masih jelek.

Kalau dibandingkan praktek pengawasan di Indonesia dengan di Korea Selatan. Pengamat penerbangan ini sempat diperiksa secara ketat ketika sampai di bandara internasional Korea Selatan. Menurutnya personel bandara Korea Selatan tidak pandang bulu, siapa saja diperiksa dan digeledah.
Ini jauh berbeda dengan di Indonesia, dimana pilot atau pramugari bisa lepas dari pemeriksaan jika sudah kenal dengan petugas bandara.

Lemahnya pengawasan di dunia penerbangan ini juga yang menjadi penyebab penggunaan narkoba di profesi ini relatif tinggi.Salah satu pramugari sebuah maskapai penerbangan yang berhasil diwawancara RCTI menyebutkan, sekira 60-70 persen awak pesawat dari seluruh maskapai penerbangan tanah air menggunakan narkoba.
Tidak hanya itu, penggunaan narkoba di kalangan pilot bahkan disinyalir sudah terjadi semenjak masih di akademi penerbangan.
Kemungkinan pilot sudah menggunakan narkoba sejak di akademi penerbangan diperkuat dengan pernyataan pengamat penerbangan ini,yang melihat banyak orang yang menjadi pilot hanya karena memiliki uang banyak. Asal ada uang bisa jadi pilot.
Sialnya, tidak hanya masalah di diri sang pilot, banyak sekolah penerbangan di Indonesia ternyata kurang memperhatikan standar yang sudah ditentukan.

Fakta yang ada saat ini, menurut saya juga mendorong masuknya sindikat narkoba ke dunia penerbangan Indonesia. Ini terjadi karena security minded orang Indonesia masih sangat lemah.
Ditambah dengan lemahnya pengawasan di bandara, semakin memperbesar kemungkinan masuknya narkoba dari luar negeri dengan memanfaatkan banyak pihak, salah satunya awak penerbangan, entah itu pilot, pramugari bahkan ground crew. Seakan-akan Indonesia itu dianggap pasar empuk bagi mafia narkoba internasional.

Oleh karena itu, seharusnya pengawasan seharusnya lebih diperketat dengan tidak hanya mengandalkan pengawasan dari internal perusahaan saja.

Dunia penerbangan Indonesia itu ketinggalan di segala lini.Jumlah dan teknologi pesawat saja sudah jauh ketinggalan. Bahkan kualitas SDM seperti pilot, pramugari, ground crew dan lainnya masih kurang,ditambah lagi dengan maraknya kasus narkoba seperti ini..Sangat menyedihkan…